prot_C-tenellus_contig7809.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7809.2.1 vs. uniprot
Match: A0A6H5K937_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K937_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 3.350e-6 Identity = 32/78 (41.03%), Postives = 43/78 (55.13%), Query Frame = 0 Query: 1 MLYADDPGIFSNTQGGWPKM-TVIVKVVRSFPPAMA-LNTEAMCLRRPNQAAAIMQIQALGQTCKQADKFVYLGDTLS 76 MLYADD I S + KM ++IV+V F ++ L E MC+ + A+GQTCKQ D+FVY G T+S Sbjct: 247 MLYADDAAIVSRSPESLEKMMSIIVRVAGLFGLMVSELKMEIMCMLPKGIEERPFTVSAVGQTCKQTDRFVYFGRTIS 324 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7809.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7809.2.1 ID=prot_C-tenellus_contig7809.2.1|Name=mRNA_C-tenellus_contig7809.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=104bpback to top |