prot_C-tenellus_contig7540.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7540.1.1 vs. uniprot
Match: A0A8C9VJW7_SCLFO (Anoctamin n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A8C9VJW7_SCLFO) HSP 1 Score: 52.0 bits (123), Expect = 2.440e-6 Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 1 LAWISNYAEIRVDAVKVLLEHRRPYPLGRQDIGTYQMVFTAIAIVSVGTNA 51 LA+++N EIRVDA K+ + RR P QDIG +Q + A+AI++V TNA Sbjct: 606 LAFLNNVVEIRVDAWKITTQFRRMVPEKAQDIGAWQPILQAVAILAVATNA 656
BLAST of mRNA_C-tenellus_contig7540.1.1 vs. uniprot
Match: A0A8C9U444_SCLFO (Anoctamin n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A8C9U444_SCLFO) HSP 1 Score: 52.0 bits (123), Expect = 2.440e-6 Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 1 LAWISNYAEIRVDAVKVLLEHRRPYPLGRQDIGTYQMVFTAIAIVSVGTNA 51 LA+++N EIRVDA K+ + RR P QDIG +Q + A+AI++V TNA Sbjct: 570 LAFLNNVVEIRVDAWKITTQFRRMVPEKAQDIGAWQPILQAVAILAVATNA 620
BLAST of mRNA_C-tenellus_contig7540.1.1 vs. uniprot
Match: A0A0P7WBS1_SCLFO (Anoctamin n=10 Tax=Scleropages formosus TaxID=113540 RepID=A0A0P7WBS1_SCLFO) HSP 1 Score: 52.0 bits (123), Expect = 2.450e-6 Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 1 LAWISNYAEIRVDAVKVLLEHRRPYPLGRQDIGTYQMVFTAIAIVSVGTNA 51 LA+++N EIRVDA K+ + RR P QDIG +Q + A+AI++V TNA Sbjct: 791 LAFLNNVVEIRVDAWKITTQFRRMVPEKAQDIGAWQPILQAVAILAVATNA 841
BLAST of mRNA_C-tenellus_contig7540.1.1 vs. uniprot
Match: A0A197JIP8_9FUNG (DUF590-domain-containing protein n=1 Tax=Linnemannia elongata AG-77 TaxID=1314771 RepID=A0A197JIP8_9FUNG) HSP 1 Score: 50.8 bits (120), Expect = 6.270e-6 Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 0 Query: 2 AWISNYAEIRVDAVKVLLEHRRPYPLGRQDIGTYQMVFTAIAIVSVGTNAGL 53 A ++N EIRVDA KVL +H+RP G QDIG++ + + +SV TNA L Sbjct: 874 ALLNNILEIRVDAYKVLTQHKRPIAQGAQDIGSWGTILMLLTHISVFTNACL 925 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7540.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7540.1.1 ID=prot_C-tenellus_contig7540.1.1|Name=mRNA_C-tenellus_contig7540.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=53bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|