prot_C-tenellus_contig7112.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7112.1.1 vs. uniprot
Match: D8LR38_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LR38_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 1.860e-10 Identity = 26/41 (63.41%), Postives = 34/41 (82.93%), Query Frame = 0 Query: 3 REKLIRESLSIPNFERVLQSSISCQHSKRKAWGSKYGSGIR 43 R++LI+E LSIPNF R LQ++I C H++ KAWG KYGSG+R Sbjct: 1492 RDRLIKEELSIPNFGRALQANIGCSHTRTKAWGDKYGSGLR 1532
BLAST of mRNA_C-tenellus_contig7112.1.1 vs. uniprot
Match: A0A662XCN2_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XCN2_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 5.710e-6 Identity = 21/41 (51.22%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 4 EKLIRESLSIPNFERVLQSS-ISCQHSKRKAWGSKYGSGIR 43 E+ +++L IPNF RV+ SS + C+H + KAWG KYGSG++ Sbjct: 267 ERRAKDALCIPNFHRVVDSSRVECEHRELKAWGGKYGSGLK 307
BLAST of mRNA_C-tenellus_contig7112.1.1 vs. uniprot
Match: A0A662X607_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662X607_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 7.820e-6 Identity = 22/40 (55.00%), Postives = 29/40 (72.50%), Query Frame = 0 Query: 5 KLIRESLSIPNFERVLQSS-ISCQHSKRKAWGSKYGSGIR 43 K +E L IPNF RV+ SS + C+H + KAWG KYGSG++ Sbjct: 970 KRAKEVLCIPNFHRVIDSSRVECEHRELKAWGGKYGSGLK 1009 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7112.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7112.1.1 ID=prot_C-tenellus_contig7112.1.1|Name=mRNA_C-tenellus_contig7112.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=44bpback to top |