prot_C-tenellus_contig10828.3.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10828.3.1 vs. uniprot
Match: D7FQZ3_ECTSI (Aminopeptidase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQZ3_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 8.330e-9 Identity = 28/43 (65.12%), Postives = 36/43 (83.72%), Query Frame = 0 Query: 1 MTTAFSSWRRFNEGRQAMMKEQLTRICNSSPSKNTLEVASRCL 43 + T FSS+RRF+E RQ +M+EQL RI +SSPSK+T EVA+RCL Sbjct: 1006 LATMFSSYRRFDEKRQGLMREQLARIRDSSPSKDTYEVATRCL 1048
BLAST of mRNA_C-tenellus_contig10828.3.1 vs. uniprot
Match: A0A7I4FVG3_PHYPA (Uncharacterized protein n=3 Tax=Physcomitrium patens TaxID=3218 RepID=A0A7I4FVG3_PHYPA) HSP 1 Score: 47.4 bits (111), Expect = 7.360e-5 Identity = 25/45 (55.56%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 1 MTTAFSSWRRFNEGRQAMMKEQLTRICNSSP-SKNTLEVASRCLA 44 M +AFS WRRF+EGRQA+ K QL RI + S N E+AS+ LA Sbjct: 849 MVSAFSRWRRFDEGRQALAKAQLERITSQDGLSDNVFEIASKSLA 893
BLAST of mRNA_C-tenellus_contig10828.3.1 vs. uniprot
Match: A0A5P1F2F9_ASPOF (Uncharacterized protein n=3 Tax=Asparagus officinalis TaxID=4686 RepID=A0A5P1F2F9_ASPOF) HSP 1 Score: 47.4 bits (111), Expect = 7.360e-5 Identity = 24/45 (53.33%), Postives = 34/45 (75.56%), Query Frame = 0 Query: 1 MTTAFSSWRRFNEGRQAMMKEQLTRICNSSP-SKNTLEVASRCLA 44 M +AFS WRR++EGRQA+ K QL RI +++ S+N E+AS+ LA Sbjct: 933 MVSAFSRWRRYDEGRQALAKAQLERIMSANGLSENVYEIASKSLA 977 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10828.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10828.3.1 ID=prot_C-tenellus_contig10828.3.1|Name=mRNA_C-tenellus_contig10828.3.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=45bpback to top |