prot_C-tenellus_contig103.12.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig103.12.1 vs. uniprot
Match: A0A1Y2EY93_9BASI (Uncharacterized protein (Fragment) n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2EY93_9BASI) HSP 1 Score: 66.6 bits (161), Expect = 1.380e-11 Identity = 38/97 (39.18%), Postives = 53/97 (54.64%), Query Frame = 0 Query: 2 YIPFRSSHPMHSKRGYITGELLRYVSTCSDKESYPEVRNKFYFKLRARGYPPWFLLLQCFEKVNYSQRAERLKPTIPRQ--DITPATFVLSYHPMWD 96 YIP+ S HP+ K ++ G LL YV + S + + R KFY++LRARGYPP +L Q F + RA L I D P + + Y+P+WD Sbjct: 13 YIPWLSFHPVWVKASFVHGVLLAYVRSSSRYDDFLGSRLKFYYRLRARGYPPRWLNKQFFLVDWHRDRASTLVDRIKAAPLDRGPLIYKVEYNPVWD 109 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig103.12.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig103.12.1 ID=prot_C-tenellus_contig103.12.1|Name=mRNA_C-tenellus_contig103.12.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=101bpback to top |