prot_C-tenellus_contig10141.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10141.1.1 vs. uniprot
Match: A0A6H5L4W1_9PHAE (PARP-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4W1_9PHAE) HSP 1 Score: 113 bits (282), Expect = 3.790e-27 Identity = 49/104 (47.12%), Postives = 66/104 (63.46%), Query Frame = 0 Query: 189 VNPWNELDDDAYLVGYSPK-GTTVCGVCGHKVAKGKLQMGIFYAHKHKFTLVKWHHLHCILPPTCFTCPMDLCGFEDIRGEDVDTVQRWLGFESDGVARDRANT 291 +NPW EL + +++GY+ G C CG K++ G+LQ+G FY H+ +FTL++WHH C+ P C T PMDLCG ED+ EDVD V RWL G +DR T Sbjct: 64 LNPWKELAPEDFVIGYARGLGRVRCSSCGCKISAGQLQLGAFYMHEDRFTLLRWHHQSCVDAPECLTSPMDLCGIEDLSPEDVDEVCRWLAHGRSGPVKDRTWT 167 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10141.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10141.1.1 ID=prot_C-tenellus_contig10141.1.1|Name=mRNA_C-tenellus_contig10141.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=293bpback to top |