mRNA_C-tenellus_contig9988.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: D2Z249_HETAK (Cytochrome c oxidase subunit 2 n=3 Tax=Heterosigma akashiwo TaxID=2829 RepID=D2Z249_HETAK) HSP 1 Score: 97.1 bits (240), Expect = 5.250e-23 Identity = 46/69 (66.67%), Postives = 54/69 (78.26%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+R++LP+ RVLVT A VL SWA+P L VKVD CPGRLNQ+ L +K G FYGQCSEICGVNH Sbjct: 168 LEVDNRIVLPVNTHIRVLVTAADVLHSWAIPSLGVKVDACPGRLNQVSLFMKREGVFYGQCSEICGVNH 236
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: A0A8F0FF00_9PHAE (Cytochrome c oxidase subunit 2 n=1 Tax=Protohalopteris sp. TaxID=2843287 RepID=A0A8F0FF00_9PHAE) HSP 1 Score: 96.3 bits (238), Expect = 1.260e-22 Identity = 48/69 (69.57%), Postives = 54/69 (78.26%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+RV+LP+ RVLVT A VL SWA+P L +KVD CPGRLNQI L LK G FYGQCSEICGVNH Sbjct: 183 LEVDNRVVLPIYTHIRVLVTGADVLHSWAIPSLGIKVDSCPGRLNQIFLFLKRDGVFYGQCSEICGVNH 251
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: A0A4Y5T816_9PHAE (Cytochrome c oxidase subunit 2 n=1 Tax=Dictyopteris divaricata TaxID=156996 RepID=A0A4Y5T816_9PHAE) HSP 1 Score: 96.3 bits (238), Expect = 1.570e-22 Identity = 49/69 (71.01%), Postives = 54/69 (78.26%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+RVILP+ RVLVT A VL SWAVP L VKVD CPGRLNQ+ L +K G FYGQCSEICGVNH Sbjct: 197 LEVDNRVILPVNTHIRVLVTGADVLHSWAVPSLGVKVDSCPGRLNQVHLFIKREGVFYGQCSEICGVNH 265
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: A0A7S6ZPE3_9STRA (Cytochrome c oxidase subunit 2 n=1 Tax=Schizocladia ischiensis TaxID=196139 RepID=A0A7S6ZPE3_9STRA) HSP 1 Score: 95.5 bits (236), Expect = 1.840e-22 Identity = 45/69 (65.22%), Postives = 52/69 (75.36%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+RV+LP R+L+T A VL SWAVP L VK D CPGRLNQ C+ +K G FYGQCSEICGVNH Sbjct: 166 LEVDNRVVLPTNTHIRLLITAADVLHSWAVPSLGVKTDACPGRLNQACIFIKREGVFYGQCSEICGVNH 234
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: A0A2P1G879_9CRYP (Cytochrome c oxidase subunit 2 n=1 Tax=Storeatula sp. CCMP1868 TaxID=195070 RepID=A0A2P1G879_9CRYP) HSP 1 Score: 95.1 bits (235), Expect = 3.370e-22 Identity = 44/69 (63.77%), Postives = 54/69 (78.26%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+ V+LP+K RVL+T A VL WA+P L VK+D CPGRLNQI L +K G+FYGQCSEICG+NH Sbjct: 169 LEVDNPVVLPVKTHVRVLITAADVLHCWAIPSLGVKIDACPGRLNQISLFIKREGTFYGQCSEICGINH 237
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: B2MWR9_HEMAN (Cytochrome c oxidase subunit 2 n=1 Tax=Hemiselmis andersenii TaxID=464988 RepID=B2MWR9_HEMAN) HSP 1 Score: 95.1 bits (235), Expect = 3.610e-22 Identity = 45/69 (65.22%), Postives = 55/69 (79.71%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+RV+LP+K RVLVT + VL SWAVP L VK+D CPGRLNQ+ + +K G FYGQCSE+CGVNH Sbjct: 178 LEVDNRVVLPVKTHIRVLVTSSDVLHSWAVPSLGVKMDACPGRLNQVSVFIKREGVFYGQCSELCGVNH 246
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: D2Z204_9STRA (Cytochrome c oxidase subunit 2 n=5 Tax=Chattonella TaxID=44439 RepID=D2Z204_9STRA) HSP 1 Score: 94.7 bits (234), Expect = 4.270e-22 Identity = 45/69 (65.22%), Postives = 53/69 (76.81%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+RV+LP+ R+LVT VL SWAVP L VKVD CPGRLNQ+ + +K G FYGQCSEICGVNH Sbjct: 172 LEVDNRVLLPVNTHIRILVTAGDVLHSWAVPSLGVKVDACPGRLNQVSIFMKREGVFYGQCSEICGVNH 240
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: Q9G8U0_RHDSA (Cytochrome c oxidase subunit 2 n=1 Tax=Rhodomonas salina TaxID=52970 RepID=Q9G8U0_RHDSA) HSP 1 Score: 94.7 bits (234), Expect = 4.730e-22 Identity = 45/69 (65.22%), Postives = 54/69 (78.26%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+ V+LP+K RVLVT A VL WAVP L VK+D CPGRLNQI L +K G+FYGQCSE+CG+NH Sbjct: 169 LEVDNPVVLPVKTHVRVLVTSADVLHCWAVPSLGVKIDACPGRLNQISLFIKREGTFYGQCSELCGINH 237
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: G1UD48_CUTMU (Cytochrome oxidase subunit 2 (Fragment) n=7 Tax=Cutleria TaxID=74474 RepID=G1UD48_CUTMU) HSP 1 Score: 92.0 bits (227), Expect = 6.000e-22 Identity = 44/69 (63.77%), Postives = 53/69 (76.81%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+R+++P RVL+T A VL SWAVP L VKVD CPGRLNQ+ L +K G FYGQCSE+CGVNH Sbjct: 101 LEVDNRLLVPTNTHIRVLITSADVLHSWAVPSLGVKVDACPGRLNQVFLFVKREGVFYGQCSELCGVNH 169
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: B1NS87_9ODON (Cytochrome c oxidase subunit 2 (Fragment) n=1 Tax=Microstigma anomalum TaxID=476818 RepID=B1NS87_9ODON) HSP 1 Score: 92.8 bits (229), Expect = 6.350e-22 Identity = 44/69 (63.77%), Postives = 51/69 (73.91%), Query Frame = 1 Query: 4 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL-LKT*GSFYGQCSEICGVNH 207 LE+D+RVILP+ AQ R+++T A VL SW VPCL VK+D PGRLNQ L G FYGQCSEICG NH Sbjct: 108 LEVDNRVILPMDAQTRIIITAADVLHSWTVPCLGVKLDATPGRLNQTSFFLSRPGLFYGQCSEICGANH 176 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9988.1.1 >prot_C-tenellus_contig9988.1.1 ID=prot_C-tenellus_contig9988.1.1|Name=mRNA_C-tenellus_contig9988.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=54bp VLEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICLback to top mRNA from alignment at C-tenellus_contig9988:3835..4041+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9988.1.1 ID=mRNA_C-tenellus_contig9988.1.1|Name=mRNA_C-tenellus_contig9988.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=207bp|location=Sequence derived from alignment at C-tenellus_contig9988:3835..4041+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9988:3835..4041+ >mRNA_C-tenellus_contig9988.1.1 ID=mRNA_C-tenellus_contig9988.1.1|Name=mRNA_C-tenellus_contig9988.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=162bp|location=Sequence derived from alignment at C-tenellus_contig9988:3835..4041+ (Choristocarpus tenellus KU2346)back to top |