prot_C-tenellus_contig9988.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: B1NS87_9ODON (Cytochrome c oxidase subunit 2 (Fragment) n=1 Tax=Microstigma anomalum TaxID=476818 RepID=B1NS87_9ODON) HSP 1 Score: 68.2 bits (165), Expect = 1.130e-12 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQ 47 LE+D+RVILP+ AQ R+++T A VL SW VPCL VK+D PGRLNQ Sbjct: 108 LEVDNRVILPMDAQTRIIITAADVLHSWTVPCLGVKLDATPGRLNQ 153
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: D8WKH4_9COLE (Cytochrome c oxidase subunit 2 n=1 Tax=Tropisternus sp. BYU-CO166 TaxID=696091 RepID=D8WKH4_9COLE) HSP 1 Score: 68.6 bits (166), Expect = 1.180e-12 Identity = 30/52 (57.69%), Postives = 38/52 (73.08%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICLLKT 53 L++D+RV+LP K Q R++VT A VL SW +P L VK+D CPGRLNQI L Sbjct: 136 LDVDNRVVLPFKTQIRMMVTAADVLHSWTIPSLSVKIDACPGRLNQISFLMN 187
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: S5FNK1_9EUKA (Cytochrome c oxidase subunit 2 n=4 Tax=Phaeocystis TaxID=33656 RepID=S5FNK1_9EUKA) HSP 1 Score: 68.6 bits (166), Expect = 1.500e-12 Identity = 31/49 (63.27%), Postives = 38/49 (77.55%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL 50 LE+D+RV+LPLK RVL+T A VL SWA+P L +K+D CPGRLNQ L Sbjct: 157 LEVDNRVVLPLKTHIRVLITAADVLHSWAIPSLGIKLDACPGRLNQTSL 205
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: D2Z249_HETAK (Cytochrome c oxidase subunit 2 n=3 Tax=Heterosigma akashiwo TaxID=2829 RepID=D2Z249_HETAK) HSP 1 Score: 68.6 bits (166), Expect = 1.810e-12 Identity = 31/49 (63.27%), Postives = 38/49 (77.55%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICL 50 LE+D+R++LP+ RVLVT A VL SWA+P L VKVD CPGRLNQ+ L Sbjct: 168 LEVDNRIVLPVNTHIRVLVTAADVLHSWAIPSLGVKVDACPGRLNQVSL 216
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: B2DD60_9STRA (Cytochrome c oxidase subunit 2 (Fragment) n=2 Tax=Eurychasma dicksonii TaxID=159317 RepID=B2DD60_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 2.330e-12 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQ 47 LE+D+RV+LP+K RV++T A VL SWAVP L VK+D CPGRLNQ Sbjct: 132 LEVDNRVVLPIKTHIRVIITSADVLHSWAVPSLGVKLDACPGRLNQ 177
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: D2IHL4_9ODON (Cytochrome oxidase subunit II (Fragment) n=2 Tax=Nehalennia TaxID=161233 RepID=D2IHL4_9ODON) HSP 1 Score: 65.1 bits (157), Expect = 2.680e-12 Identity = 29/46 (63.04%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQ 47 LE+D+R++LPL+AQ RVLVT A VL SW +P L +KVD PGR+NQ Sbjct: 16 LEVDNRIVLPLQAQVRVLVTAADVLHSWTIPSLGIKVDATPGRINQ 61
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: Q9ZYB8_ISCVE (Cytochrome oxidase II (Fragment) n=20 Tax=Coenagrionidae TaxID=70895 RepID=Q9ZYB8_ISCVE) HSP 1 Score: 65.1 bits (157), Expect = 3.560e-12 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQ 47 LE+D+RV+LP++AQ R+LVT A VL SW VP L VKVD PGR+NQ Sbjct: 22 LEVDNRVVLPMQAQVRILVTAADVLHSWTVPSLGVKVDATPGRINQ 67
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: B1NS73_9ODON (Cytochrome c oxidase subunit 2 (Fragment) n=1 Tax=Mortonagrion binocellata TaxID=476798 RepID=B1NS73_9ODON) HSP 1 Score: 67.0 bits (162), Expect = 3.700e-12 Identity = 31/46 (67.39%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQ 47 LE+D+RVILP+K Q R+L+T A VL SWAVP L VKVD PGR+NQ Sbjct: 119 LEVDNRVILPMKTQIRILITAADVLHSWAVPALGVKVDATPGRINQ 164
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: Q85J59_ANTGR (Cytochrome oxidase subunit II (Fragment) n=2 Tax=Anthonomus grandis TaxID=7044 RepID=Q85J59_ANTGR) HSP 1 Score: 64.7 bits (156), Expect = 3.800e-12 Identity = 31/52 (59.62%), Postives = 38/52 (73.08%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQICLLKT 53 L++D+RVILP+ +Q R+LVT A V+ SW VP L VKVD PGRLNQI L Sbjct: 51 LDVDNRVILPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLNQINFLMN 102
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Match: B2MWR9_HEMAN (Cytochrome c oxidase subunit 2 n=1 Tax=Hemiselmis andersenii TaxID=464988 RepID=B2MWR9_HEMAN) HSP 1 Score: 67.8 bits (164), Expect = 3.940e-12 Identity = 31/47 (65.96%), Postives = 38/47 (80.85%), Query Frame = 0 Query: 2 LEIDDRVILPLKAQNRVLVTLAGVLLSWAVPCLDVKVDYCPGRLNQI 48 LE+D+RV+LP+K RVLVT + VL SWAVP L VK+D CPGRLNQ+ Sbjct: 178 LEVDNRVVLPVKTHIRVLVTSSDVLHSWAVPSLGVKMDACPGRLNQV 224 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9988.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9988.1.1 ID=prot_C-tenellus_contig9988.1.1|Name=mRNA_C-tenellus_contig9988.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=54bpback to top |