mRNA_C-tenellus_contig973.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: D7G5B1_ECTSI (Flagellar associated protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5B1_ECTSI) HSP 1 Score: 115 bits (288), Expect = 2.690e-28 Identity = 53/70 (75.71%), Postives = 62/70 (88.57%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHKV 210 DFVVGT +AY+VAC+ASAFEELDPERRRGSVLVQGMVGSV CVA HP P+L ++ ESG++HLWDY+ KV Sbjct: 390 DFVVGTNRAYVVACAASAFEELDPERRRGSVLVQGMVGSVACVAAHPLLPRLVILCESGDVHLWDYNLKV 459
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: A0A7S3AZA4_9EUKA (Hypothetical protein n=1 Tax=Haptolina ericina TaxID=156174 RepID=A0A7S3AZA4_9EUKA) HSP 1 Score: 78.2 bits (191), Expect = 3.520e-15 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 DFV+GT A IVAC+A+ F EL+P+ RRG++LVQG +V+ +ATHP + AV G +G + LWDY + Sbjct: 338 DFVIGTTNALIVACNAAMFGELEPDARRGTLLVQGQDAAVSGLATHPSLTRFAVCGRAGLLQLWDYSER 406
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: W2QWE4_PHYPN (Uncharacterized protein n=14 Tax=Phytophthora TaxID=4783 RepID=W2QWE4_PHYPN) HSP 1 Score: 78.2 bits (191), Expect = 3.530e-15 Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 DF+V T A+IV SA+ F E +P+RRRG++L+QG+ S++ +ATHPR PQLA+ SG + LWDY K Sbjct: 414 DFIVSTASAFIVGMSATLFGEHEPDRRRGTLLMQGINDSIHGLATHPRLPQLALSSYSGVVQLWDYSAK 482
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: A0A3R7GKJ3_9STRA (Uncharacterized protein n=1 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7GKJ3_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 1.210e-14 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 DF+V T A+IV +AS F E +P+RRRG++L+QG+ S++ +A HPR PQLA+ SG + LWDY K Sbjct: 73 DFIVSTASAFIVGMNASLFAEHEPDRRRGTLLMQGINDSIHGLAAHPRLPQLALSSYSGVVQLWDYSAK 141
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: A0A3R7J2T4_9STRA (Uncharacterized protein n=3 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7J2T4_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 1.240e-14 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 DF+V T A+IV +AS F E +P+RRRG++L+QG+ S++ +A HPR PQLA+ SG + LWDY K Sbjct: 26 DFIVSTASAFIVGMNASLFAEHEPDRRRGTLLMQGINDSIHGLAAHPRLPQLALSSYSGVVQLWDYSAK 94
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: H3GM44_PHYRM (Uncharacterized protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GM44_PHYRM) HSP 1 Score: 75.1 bits (183), Expect = 4.280e-14 Identity = 35/69 (50.72%), Postives = 48/69 (69.57%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 +F+V T A+IV SA F E +PERRRG++L+QG+ S++ +A HPR PQLA+ SG + LWDY K Sbjct: 414 EFIVSTASAFIVGMSAGLFAEHEPERRRGTLLMQGINDSIHGLAAHPRLPQLALSSYSGVVQLWDYAAK 482
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: A0A225VX07_9STRA (Uncharacterized protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A225VX07_9STRA) HSP 1 Score: 74.7 bits (182), Expect = 5.840e-14 Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 DF+V T A+IV SA F E + ERRRG++L+QG+ S++ +A HPR PQLA+ SG + LWDY K Sbjct: 418 DFIVSTASAFIVGMSAGLFGEHESERRRGTLLMQGINDSIHGLAAHPRLPQLAISSYSGVVQLWDYSAK 486
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: A0A2V2WZF4_TRYCR (ANAPC4_WD40 domain-containing protein n=1 Tax=Trypanosoma cruzi TaxID=5693 RepID=A0A2V2WZF4_TRYCR) HSP 1 Score: 73.6 bits (179), Expect = 1.480e-13 Identity = 29/69 (42.03%), Postives = 46/69 (66.67%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 DF++ T A I+ ++ AF + E RG ++VQG ++C+A HP+ PQLA+ G SG++H+WDY+ K Sbjct: 416 DFMISTAHAMIIDVASKAFHTGNAELLRGKLIVQGQEKGIHCIAAHPKLPQLAIAGHSGDVHIWDYNSK 484
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: V5B2C6_TRYCR (ANAPC4_WD40 domain-containing protein n=8 Tax=Trypanosoma cruzi TaxID=5693 RepID=V5B2C6_TRYCR) HSP 1 Score: 73.6 bits (179), Expect = 1.490e-13 Identity = 29/69 (42.03%), Postives = 46/69 (66.67%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 DF++ T A I+ ++ AF + E RG ++VQG ++C+A HP+ PQLA+ G SG++H+WDY+ K Sbjct: 456 DFMISTAHAMIIDVASKAFHTGNAELLRGKLIVQGQEKGIHCIAAHPKLPQLAIAGHSGDVHIWDYNSK 524
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Match: A0A8K1C420_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1C420_PYTOL) HSP 1 Score: 73.2 bits (178), Expect = 2.030e-13 Identity = 34/69 (49.28%), Postives = 48/69 (69.57%), Query Frame = 1 Query: 1 DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPQLAVVGESGNIHLWDYDHK 207 DFVVGT A+IV SA F E + ERRRG++L+QG+ ++ +ATHP+ QLA+ SG + LWDY+ + Sbjct: 409 DFVVGTASAFIVGMSADLFAEHEAERRRGTLLMQGINDEIHGLATHPKYSQLALSSYSGAVQLWDYNSR 477 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig973.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig973.1.1 >prot_C-tenellus_contig973.1.1 ID=prot_C-tenellus_contig973.1.1|Name=mRNA_C-tenellus_contig973.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=74bp DFVVGTQQAYIVACSASAFEELDPERRRGSVLVQGMVGSVNCVATHPRKPback to top mRNA from alignment at C-tenellus_contig973:2091..3022+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig973.1.1 ID=mRNA_C-tenellus_contig973.1.1|Name=mRNA_C-tenellus_contig973.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=932bp|location=Sequence derived from alignment at C-tenellus_contig973:2091..3022+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig973:2091..3022+ >mRNA_C-tenellus_contig973.1.1 ID=mRNA_C-tenellus_contig973.1.1|Name=mRNA_C-tenellus_contig973.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=222bp|location=Sequence derived from alignment at C-tenellus_contig973:2091..3022+ (Choristocarpus tenellus KU2346)back to top |