mRNA_C-tenellus_contig7771.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7771.2.1 vs. uniprot
Match: D8LJ92_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LJ92_ECTSI) HSP 1 Score: 92.0 bits (227), Expect = 7.750e-21 Identity = 47/70 (67.14%), Postives = 57/70 (81.43%), Query Frame = 1 Query: 1 KRFLTSEAATRRRLATALSARTIKITPDILSGLLFLLLFLFVLVTGLGCLGDIECPQSFATVQPAAGKEY 210 +R L +E+ RRLAT RTIKITPDIL+GLL LLLFLF+LVTGLGC+GDIECP+SF++ PA G+EY Sbjct: 228 RRSLKAESRAHRRLATESLTRTIKITPDILAGLLTLLLFLFILVTGLGCVGDIECPKSFSSEDPAKGREY 297
BLAST of mRNA_C-tenellus_contig7771.2.1 vs. uniprot
Match: A0A7S2WS17_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WS17_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 6.390e-7 Identity = 27/59 (45.76%), Postives = 41/59 (69.49%), Query Frame = 1 Query: 34 RRLATALSARTIKITPDILSGLLFLLLFLFVLVTGLGCLGDIECPQSFATVQPAAGKEY 210 RRL++A S + +++TPDIL+GLL +L + +TGL CLG I+ P F+ V P + +EY Sbjct: 210 RRLSSASSTQGVRMTPDILAGLLTGILLTVIALTGLCCLGSIQTPTKFSDVPPPSTREY 268 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7771.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig7771.2.1 >prot_C-tenellus_contig7771.2.1 ID=prot_C-tenellus_contig7771.2.1|Name=mRNA_C-tenellus_contig7771.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=71bp KRFLTSEAATRRRLATALSARTIKITPDILSGLLFLLLFLFVLVTGLGCLback to top mRNA from alignment at C-tenellus_contig7771:6282..6494- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig7771.2.1 ID=mRNA_C-tenellus_contig7771.2.1|Name=mRNA_C-tenellus_contig7771.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=213bp|location=Sequence derived from alignment at C-tenellus_contig7771:6282..6494- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig7771:6282..6494- >mRNA_C-tenellus_contig7771.2.1 ID=mRNA_C-tenellus_contig7771.2.1|Name=mRNA_C-tenellus_contig7771.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=213bp|location=Sequence derived from alignment at C-tenellus_contig7771:6282..6494- (Choristocarpus tenellus KU2346)back to top |