mRNA_C-tenellus_contig739.9.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig739.9.1 vs. uniprot
Match: D8LHA9_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LHA9_ECTSI) HSP 1 Score: 103 bits (256), Expect = 1.540e-27 Identity = 45/69 (65.22%), Postives = 55/69 (79.71%), Query Frame = 1 Query: 1 MTTVLWHKLPFRKFIFHELKRDGCRPFMIGLGVAFFTFGVYPAMGLTDEDRKNSVYYQQRMRTMVYSDH 207 M V WHKLP+R+ I HE++RDG +PF IG+G++ F GV P++G TDEDRKNSVYYQQRMRTM Y DH Sbjct: 1 MPPVHWHKLPWRQLISHEIRRDGFKPFFIGMGISAFLCGVVPSIGFTDEDRKNSVYYQQRMRTMKYEDH 69 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig739.9.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig739.9.1 >prot_C-tenellus_contig739.9.1 ID=prot_C-tenellus_contig739.9.1|Name=mRNA_C-tenellus_contig739.9.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=70bp MTTVLWHKLPFRKFIFHELKRDGCRPFMIGLGVAFFTFGVYPAMGLTDEDback to top mRNA from alignment at C-tenellus_contig739:10836..11622+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig739.9.1 ID=mRNA_C-tenellus_contig739.9.1|Name=mRNA_C-tenellus_contig739.9.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=787bp|location=Sequence derived from alignment at C-tenellus_contig739:10836..11622+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig739:10836..11622+ >mRNA_C-tenellus_contig739.9.1 ID=mRNA_C-tenellus_contig739.9.1|Name=mRNA_C-tenellus_contig739.9.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=210bp|location=Sequence derived from alignment at C-tenellus_contig739:10836..11622+ (Choristocarpus tenellus KU2346)back to top |