mRNA_C-tenellus_contig11025.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig11025.2.1 vs. uniprot
Match: D8LB37_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LB37_ECTSI) HSP 1 Score: 58.9 bits (141), Expect = 1.410e-7 Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 3 Query: 51 SSVLLGHPVQEGTRYAEGLLFGTVNRRLGTETGDTHEERSVAHRE 185 +S G ++GTRY +GLLFG+VNRR GTET D HE R+ HRE Sbjct: 22 ASPYAGSEPRKGTRYTDGLLFGSVNRRQGTETEDDHERRATTHRE 66 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig11025.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig11025.2.1 >prot_C-tenellus_contig11025.2.1 ID=prot_C-tenellus_contig11025.2.1|Name=mRNA_C-tenellus_contig11025.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=62bp MSSFKGVCSFSSVLLGHPVQEGTRYAEGLLFGTVNRRLGTETGDTHEERSback to top mRNA from alignment at C-tenellus_contig11025:1375..2250- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig11025.2.1 ID=mRNA_C-tenellus_contig11025.2.1|Name=mRNA_C-tenellus_contig11025.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=876bp|location=Sequence derived from alignment at C-tenellus_contig11025:1375..2250- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig11025:1375..2250- >mRNA_C-tenellus_contig11025.2.1 ID=mRNA_C-tenellus_contig11025.2.1|Name=mRNA_C-tenellus_contig11025.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=186bp|location=Sequence derived from alignment at C-tenellus_contig11025:1375..2250- (Choristocarpus tenellus KU2346)back to top |