mRNA_C-tenellus_contig10796.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10796.1.1 vs. uniprot
Match: A0A836CEK3_9STRA (P-loop containing nucleoside triphosphate hydrolase protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CEK3_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 6.240e-5 Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 1 Query: 1 QIVLTKADLLNPEDLSSCVRLLREDLQSFPG-LVETVPV--VCGTAGAGVTALWQEL 162 Q+VLTK DLL PE L+ + + +DL L+ P+ VCG GAGVTALW+ + Sbjct: 234 QLVLTKGDLLLPEQLAQSMAAVTQDLMDIGAKLLAKPPILPVCGHTGAGVTALWENM 290 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10796.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10796.1.1 >prot_C-tenellus_contig10796.1.1 ID=prot_C-tenellus_contig10796.1.1|Name=mRNA_C-tenellus_contig10796.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=56bp QIVLTKADLLNPEDLSSCVRLLREDLQSFPGLVETVPVVCGTAGAGVTALback to top mRNA from alignment at C-tenellus_contig10796:2760..2927+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10796.1.1 ID=mRNA_C-tenellus_contig10796.1.1|Name=mRNA_C-tenellus_contig10796.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=168bp|location=Sequence derived from alignment at C-tenellus_contig10796:2760..2927+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10796:2760..2927+ >mRNA_C-tenellus_contig10796.1.1 ID=mRNA_C-tenellus_contig10796.1.1|Name=mRNA_C-tenellus_contig10796.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=168bp|location=Sequence derived from alignment at C-tenellus_contig10796:2760..2927+ (Choristocarpus tenellus KU2346)back to top |