prot_C-linearis_contig10.451.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig10.451.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 14
ZOOM
x 1
POSITION
0
MKFATMMVALVAAVASLAVGDAFVMPTAAPARLARNAGAALAPTTSQPAPSRSAGASAVGALNVKIVLGEEENVEAALMRFRRTVSRSGHLQELRWKRNFETVAERKKRKRATNLRKDKIQRSRDRKANEHKF*102030405060708090100110120130Expect = 1.37e-57 / Id = 86.67Expect = 1.04e-10 / Id = 54.93Expect = 1.39e-10 / Id = 43.24Expect = 4.63e-6 / Id = 53.06Expect = 5.99e-6 / Id = 49.18Expect = 6.00e-6 / Id = 48.61Expect = 7.58e-6 / Id = 48.61Expect = 9.93e-6 / Id = 46.77Expect = 1.02e-5 / Id = 57.14Expect = 1.43e-5 / Id = 57.14SequenceA0A6H5K1E2_9PHAEA0A835YQE4_9STRAA0A835ZBS8_9STRAUPI00037B4196R7QFR2_CHOCRA0A7S1XR96_9STRAA0A7S1U4W2_9STRAA0A2V3J354_9FLORA0A1Z5J736_FISSOA0A448ZPW2_9STRA
Match NameE-valueIdentityDescription
A0A6H5K1E2_9PHAE1.370e-5786.67Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A835YQE4_9STRA1.040e-1054.93Ribosomal protein S21-domain-containing protein n=... [more]
A0A835ZBS8_9STRA1.390e-1043.24Chloroplast 30S ribosomal protein 21 n=1 Tax=Tribo... [more]
UPI00037B41964.630e-653.0630S ribosomal protein S21 n=1 Tax=Oscillatoria sp.... [more]
R7QFR2_CHOCR5.990e-649.18Uncharacterized protein n=1 Tax=Chondrus crispus T... [more]
A0A7S1XR96_9STRA6.000e-648.61Hypothetical protein n=1 Tax=Phaeomonas parva TaxI... [more]
A0A7S1U4W2_9STRA7.580e-648.61Hypothetical protein n=1 Tax=Phaeomonas parva TaxI... [more]
A0A2V3J354_9FLOR9.930e-646.7730S ribosomal protein S21 n=1 Tax=Gracilariopsis c... [more]
A0A1Z5J736_FISSO1.020e-557.14Uncharacterized protein n=2 Tax=Fistulifera solari... [more]
A0A448ZPW2_9STRA1.430e-557.14Uncharacterized protein n=1 Tax=Pseudo-nitzschia m... [more]

Pages

back to top