prot_C-linearis_contig99.17180.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig99.17180.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MPVLELVTVGELEGVPRSTRARLTIEQVNAAVAEIQRAGERRHAFISKPRKKMSEKQRNRLEELLQQEVPAHGGEPFISEPDLRALPAFKKGEMTAKALIATLRNLKRLKGVRGAGMMTYVVQGG*102030405060708090100110120Expect = 1.30e-65 / Id = 89.08Expect = 3.77e-62 / Id = 89.08Expect = 1.51e-24 / Id = 40.65Expect = 7.11e-13 / Id = 33.33Expect = 4.45e-12 / Id = 33.62Expect = 2.18e-11 / Id = 31.62Expect = 4.27e-11 / Id = 32.48Expect = 4.33e-11 / Id = 31.62Expect = 5.96e-11 / Id = 34.19Expect = 8.25e-11 / Id = 35.04SequenceD8LPM8_ECTSIA0A6H5KVT8_9PHAEA0A835YPY4_9STRAA0A7K6LCH4_9CORVA0A852JT92_SPIPAA0A7L0L6I0_9SYLVA0A7K6CG84_PTIVIA0A7K7WXV1_9PASSA0A7L2VD82_9AVESA0A7L4DWQ0_9AVES
Match NameE-valueIdentityDescription
D8LPM8_ECTSI1.300e-6589.08Similar to C18orf24 protein n=1 Tax=Ectocarpus sil... [more]
A0A6H5KVT8_9PHAE3.770e-6289.08Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A835YPY4_9STRA1.510e-2440.65C18orf24 protein-like protein n=1 Tax=Tribonema mi... [more]
A0A7K6LCH4_9CORV7.110e-1333.33Spindle and kinetochore-associated protein 1 (Frag... [more]
A0A852JT92_SPIPA4.450e-1233.62Spindle and kinetochore-associated protein 1 (Frag... [more]
A0A7L0L6I0_9SYLV2.180e-1131.62Spindle and kinetochore-associated protein 1 (Frag... [more]
A0A7K6CG84_PTIVI4.270e-1132.48Spindle and kinetochore-associated protein 1 (Frag... [more]
A0A7K7WXV1_9PASS4.330e-1131.62Spindle and kinetochore-associated protein 1 (Frag... [more]
A0A7L2VD82_9AVES5.960e-1134.19Spindle and kinetochore-associated protein 1 (Frag... [more]
A0A7L4DWQ0_9AVES8.250e-1135.04Spindle and kinetochore-associated protein 1 (Frag... [more]

Pages

back to top