prot_C-linearis_contig97.17080.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig97.17080.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MSGKKDKASAEDLHVMDTVEQYESYEDYLDSQVTETDMYYLQDEDLARQLVELGYRGSGDTLQREEFEARKKALRERSTQKTNAPKQLSSSGKDLSKSPFLLALGNREELVRNGKLTSIIFVRDVNCKGQEVSGYIDYAHRLRSTNFEPYFERRKKLMPRPTDLSYYNWETQTSTSTSTPNFQVIADGEAGLLFKNKRDRKVVNVDPKAPPGDNTTRTEIRTPEYRQVVIYDHMTRRKS*20406080100120140160180200220240Expect = 6.91e-162 / Id = 98.33Expect = 4.26e-120 / Id = 74.79Expect = 9.21e-120 / Id = 78.03Expect = 1.50e-119 / Id = 77.53Expect = 2.79e-117 / Id = 75.34Expect = 2.82e-116 / Id = 77.68Expect = 4.60e-116 / Id = 74.34Expect = 3.11e-110 / Id = 74.21Expect = 3.18e-109 / Id = 73.45Expect = 3.76e-109 / Id = 69.62SequenceD7G2R9_ECTSIA0A835ZKU0_9STRAF0Y4F2_AURANA0A7S1CI53_9STRAA0A1V9Z039_9STRAA0A2R5GCS3_9STRAH3G868_PHYRMA0A812J512_9DINOA0A3R7IPN8_9STRAA0A397FJ49_9STRA
Match NameE-valueIdentityDescription
D7G2R9_ECTSI6.910e-16298.33Cilia- and flagella-associated protein 299 n=2 Tax... [more]
A0A835ZKU0_9STRA4.260e-12074.79Cilia- and flagella-associated protein 299 n=1 Tax... [more]
F0Y4F2_AURAN9.210e-12078.03Cilia- and flagella-associated protein 299 n=1 Tax... [more]
A0A7S1CI53_9STRA1.500e-11977.53Cilia- and flagella-associated protein 299 n=1 Tax... [more]
A0A1V9Z039_9STRA2.790e-11775.34Cilia- and flagella-associated protein 299 n=10 Ta... [more]
A0A2R5GCS3_9STRA2.820e-11677.68Cilia- and flagella-associated protein 299 n=1 Tax... [more]
H3G868_PHYRM4.600e-11674.34Cilia- and flagella-associated protein 299 n=24 Ta... [more]
A0A812J512_9DINO3.110e-11074.21Cilia- and flagella-associated protein 299 n=1 Tax... [more]
A0A3R7IPN8_9STRA3.180e-10973.45Cilia- and flagella-associated protein 299 n=2 Tax... [more]
A0A397FJ49_9STRA3.760e-10969.62Cilia- and flagella-associated protein 299 n=4 Tax... [more]

Pages

back to top