prot_C-linearis_contig96.17049.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig96.17049.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 5
ZOOM
x 1
POSITION
0
SGVTPLHRAAEVNSCQVAQVLINAEASVNARTAWGWYAPLHFALQNGHEQVAEVLLQAGAKWTILTKRLRTPYDLAVSRGLKLQALRIQDVRHSIAK102030405060708090Expect = 2.06e-21 / Id = 91.11Expect = 1.21e-9 / Id = 37.11Expect = 4.05e-8 / Id = 39.56Expect = 7.46e-6 / Id = 34.88Expect = 1.04e-5 / Id = 49.21SequenceD7G4B2_ECTSIA0A7S4A937_9STRAT0Q147_SAPDVC1C0P9_CALCMA0A8K1CK32_PYTOL
Match NameE-valueIdentityDescription
D7G4B2_ECTSI2.060e-2191.11Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
A0A7S4A937_9STRA1.210e-937.11Hypothetical protein n=1 Tax=Pelagomonas calceolat... [more]
T0Q147_SAPDV4.050e-839.56Uncharacterized protein n=1 Tax=Saprolegnia diclin... [more]
C1C0P9_CALCM7.460e-634.88Dysferlin-interacting protein 1 n=4 Tax=Caligidae ... [more]
A0A8K1CK32_PYTOL1.040e-549.21Uncharacterized protein n=1 Tax=Pythium oligandrum... [more]
back to top