Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig95.16971.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
| Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..29 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 30..137 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 10..21 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 22..29 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..9 |
| None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..18 score: 0.794 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-linearis_contig95.16971.1 ID=prot_C-linearis_contig95.16971.1|Name=mRNA_C-linearis_contig95.16971.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=137bp MWMSVSMWPVLCWTCLAAAAVPAAGTCKARASSPAFTARLASRSPPMGAS PPLPPLPAAFAFARPRHALSLGGQRHPPRQRRRRRHQQRRQSRAPRMLCS SPSFSSERPGLVSREQLLAAPWQRSIGAASFSHSSSC back to top
|