prot_C-linearis_contig104.911.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig104.911.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MGYNELGNDWQHSLVLATGSADGSIHVFDLSKGQGDEMQTLRGHRDRVYSADFHPTEPKLVSCSADKTVRIWEPNRKRNTRK*1020304050607080Expect = 9.04e-51 / Id = 91.46Expect = 5.85e-46 / Id = 91.46Expect = 1.86e-35 / Id = 66.67Expect = 7.66e-19 / Id = 55.56Expect = 2.02e-18 / Id = 55.71Expect = 9.65e-18 / Id = 56.52Expect = 1.72e-17 / Id = 47.22Expect = 1.40e-15 / Id = 50.77Expect = 3.17e-14 / Id = 45.98Expect = 1.12e-13 / Id = 51.61SequenceD8LEF6_ECTSIA0A6H5KNQ7_9PHAEA0A835Z281_9STRAA0A8J4PPE8_9MYCER7QRT1_CHOCRA0A2V3IL28_9FLORA0A8H7Q4N1_MORISA0A168T094_ABSGLT0QW05_SAPDVA0A2P6MV32_9EUKA
Match NameE-valueIdentityDescription
D8LEF6_ECTSI9.040e-5191.46Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
A0A6H5KNQ7_9PHAE5.850e-4691.46Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A835Z281_9STRA1.860e-3566.67Uncharacterized protein n=1 Tax=Tribonema minus Ta... [more]
A0A8J4PPE8_9MYCE7.660e-1955.56Uncharacterized protein n=1 Tax=Polysphondylium vi... [more]
R7QRT1_CHOCR2.020e-1855.71Uncharacterized protein n=1 Tax=Chondrus crispus T... [more]
A0A2V3IL28_9FLOR9.650e-1856.52WD repeat-containing protein 5B n=1 Tax=Gracilario... [more]
A0A8H7Q4N1_MORIS1.720e-1747.22GED domain-containing protein n=1 Tax=Mortierella ... [more]
A0A168T094_ABSGL1.400e-1550.77Uncharacterized protein n=1 Tax=Absidia glauca Tax... [more]
T0QW05_SAPDV3.170e-1445.98Uncharacterized protein n=2 Tax=Saprolegnia TaxID=... [more]
A0A2P6MV32_9EUKA1.120e-1351.61Uncharacterized protein n=1 Tax=Planoprotostelium ... [more]

Pages

back to top