prot_C-linearis_contig104.884.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig104.884.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MADTMRFCSECNNIMHPKENKADRKLVYACNRCSYKEDAQSGSCIYRNNLITTAGNKLDIVQTDVVDDPTLQRSKNAICEKCNYNEAVFFQADEGAKSQSLSLIFVCTNRACGHKWVS*102030405060708090100110Expect = 3.98e-80 / Id = 94.92Expect = 6.62e-52 / Id = 69.03Expect = 1.70e-34 / Id = 50.44Expect = 5.62e-33 / Id = 47.79Expect = 1.28e-32 / Id = 47.32Expect = 2.96e-32 / Id = 52.17Expect = 8.96e-32 / Id = 44.74Expect = 1.23e-31 / Id = 47.79Expect = 1.52e-31 / Id = 49.11Expect = 1.80e-31 / Id = 48.21SequenceD8LE56_ECTSIA0A835YYP5_9STRAA0A1Y1IMB2_KLENIA0A1B6PTV6_SORBIA0A7S3NJ32_9STRAB8BUI2_THAPSA0A8H7UCI9_9FUNGA0A843UFX2_COLESUPI001D0951AAA0A8B7CCB1_PHODC
Match NameE-valueIdentityDescription
D8LE56_ECTSI3.980e-8094.92TFIIS-type domain-containing protein n=1 Tax=Ectoc... [more]
A0A835YYP5_9STRA6.620e-5269.03DNA-directed RNA polymerase subunit n=1 Tax=Tribon... [more]
A0A1Y1IMB2_KLENI1.700e-3450.44DNA-directed RNA polymerase subunit n=1 Tax=Klebso... [more]
A0A1B6PTV6_SORBI5.620e-3347.79DNA-directed RNA polymerase subunit n=2 Tax=Androp... [more]
A0A7S3NJ32_9STRA1.280e-3247.32Hypothetical protein n=1 Tax=Aureoumbra lagunensis... [more]
B8BUI2_THAPS2.960e-3252.17DNA-directed RNA polymerase subunit n=1 Tax=Thalas... [more]
A0A8H7UCI9_9FUNG8.960e-3244.74DNA-directed RNA polymerase subunit n=2 Tax=Umbelo... [more]
A0A843UFX2_COLES1.230e-3147.79TFIIS-type domain-containing protein n=1 Tax=Coloc... [more]
UPI001D0951AA1.520e-3149.11DNA-directed RNA polymerase II subunit RPB9 n=1 Ta... [more]
A0A8B7CCB1_PHODC1.800e-3148.21DNA-directed RNA polymerase subunit n=3 Tax=Arecac... [more]

Pages

back to top