prot_C-linearis_contig103.817.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig103.817.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 6
ZOOM
x 1
POSITION
0
TRVVSNTSPNSVILELQNFTVPEGTKYEDYLSKLQGLVGSAQTLGHVTPQDSTLQFAVRESVGDQFGLLTASILKNKEAGKVPFASIKEFMDE102030405060708090Expect = 3.86e-26 / Id = 55.43Expect = 4.08e-24 / Id = 55.43Expect = 9.97e-22 / Id = 53.26Expect = 6.14e-21 / Id = 56.25Expect = 1.58e-20 / Id = 54.22Expect = 8.66e-16 / Id = 56.25SequenceD7G674_ECTSIA0A6H5KBL4_9PHAEA0A6H5KRF6_9PHAEA0A6H5K255_9PHAEA0A6H5K0Q4_9PHAEA0A6H5JYQ6_9PHAE
Match NameE-valueIdentityDescription
D7G674_ECTSI3.860e-2655.43CCHC-type domain-containing protein n=1 Tax=Ectoca... [more]
A0A6H5KBL4_9PHAE4.080e-2455.43CCHC-type domain-containing protein n=2 Tax=Ectoca... [more]
A0A6H5KRF6_9PHAE9.970e-2253.26CCHC-type domain-containing protein n=1 Tax=Ectoca... [more]
A0A6H5K255_9PHAE6.140e-2156.25Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5K0Q4_9PHAE1.580e-2054.22Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JYQ6_9PHAE8.660e-1656.25Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
back to top