prot_C-linearis_contig102.807.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig102.807.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
VSSLNKKATVPHRREVLSRVRAVKRGLESEVALMLDDEFVAITTDGWTSRSNESYSSLTVAYIDSEWNLHHIYLECAKHTGTTTGEDLANEIAGMIERHDLTGRVTACVTDCEPSMVKAGRL102030405060708090100110120Expect = 6.31e-61 / Id = 81.97Expect = 1.23e-55 / Id = 76.23Expect = 1.74e-32 / Id = 52.46Expect = 4.65e-27 / Id = 45.08Expect = 1.91e-20 / Id = 55.29Expect = 3.36e-15 / Id = 54.05Expect = 8.82e-13 / Id = 36.28Expect = 4.67e-11 / Id = 43.24Expect = 1.91e-10 / Id = 36.47Expect = 4.46e-10 / Id = 32.74SequenceD8LCS5_ECTSIA0A6H5KUY5_9PHAEA0A6H5JJV8_9PHAEA0A6H5L7Y8_9PHAEA0A6H5JHP9_9PHAEA0A6H5KVI1_9PHAEA0A6J1Q6G9_9HYMEA0A6G0XUK0_APHCRUPI00100E6752UPI001FBAC49D
Match NameE-valueIdentityDescription
D8LCS5_ECTSI6.310e-6181.97Dimer_Tnp_hAT domain-containing protein n=2 Tax=Ec... [more]
A0A6H5KUY5_9PHAE1.230e-5576.23Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JJV8_9PHAE1.740e-3252.46Dimer_Tnp_hAT domain-containing protein n=1 Tax=Ec... [more]
A0A6H5L7Y8_9PHAE4.650e-2745.08Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JHP9_9PHAE1.910e-2055.29Autophagy protein 5 n=1 Tax=Ectocarpus sp. CCAP 13... [more]
A0A6H5KVI1_9PHAE3.360e-1554.05Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6J1Q6G9_9HYME8.820e-1336.28zinc finger BED domain-containing protein 1-like n... [more]
A0A6G0XUK0_APHCR4.670e-1143.24Zinc finger BED domain-containing protein 6-like (... [more]
UPI00100E67521.910e-1036.47zinc finger BED domain-containing protein 4-like n... [more]
UPI001FBAC49D4.460e-1032.74E3 SUMO-protein ligase ZBED1-like n=1 Tax=Pieris n... [more]

Pages

back to top