prot_C-linearis_contig101.754.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig101.754.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 20
ZOOM
x 1
POSITION
0
MVSIQDNTFNTNQYKYFLALIVVVDKENFTQIAMQALLSNERTEDFVFLFRTFRELIGGAQPQV51015202530354045505560Expect = 8.15e-25 / Id = 80.65Expect = 6.91e-24 / Id = 79.37Expect = 1.53e-23 / Id = 77.78Expect = 2.61e-23 / Id = 83.33Expect = 2.85e-22 / Id = 76.92Expect = 2.55e-21 / Id = 75.81Expect = 3.50e-21 / Id = 73.02Expect = 1.97e-19 / Id = 81.48Expect = 4.50e-18 / Id = 66.67Expect = 1.57e-17 / Id = 78.85SequenceA0A6H5KJW1_9PHAEA0A6H5JYV9_9PHAEA0A6H5KQ14_9PHAEA0A6H5KGZ7_9PHAEA0A6H5K030_9PHAEA0A6H5KFX3_9PHAEA0A6H5JXK5_9PHAEA0A6H5JG50_9PHAED7G8C7_ECTSIA0A6H5K2Y1_9PHAE
Match NameE-valueIdentityDescription
A0A6H5KJW1_9PHAE8.150e-2580.65MULE domain-containing protein n=1 Tax=Ectocarpus ... [more]
A0A6H5JYV9_9PHAE6.910e-2479.37SWIM-type domain-containing protein n=1 Tax=Ectoca... [more]
A0A6H5KQ14_9PHAE1.530e-2377.78SWIM-type domain-containing protein n=1 Tax=Ectoca... [more]
A0A6H5KGZ7_9PHAE2.610e-2383.33MULE domain-containing protein (Fragment) n=1 Tax=... [more]
A0A6H5K030_9PHAE2.850e-2276.92MULE domain-containing protein n=1 Tax=Ectocarpus ... [more]
A0A6H5KFX3_9PHAE2.550e-2175.81SWIM-type domain-containing protein n=1 Tax=Ectoca... [more]
A0A6H5JXK5_9PHAE3.500e-2173.02SWIM-type domain-containing protein n=2 Tax=Ectoca... [more]
A0A6H5JG50_9PHAE1.970e-1981.48MULE domain-containing protein n=1 Tax=Ectocarpus ... [more]
D7G8C7_ECTSI4.500e-1866.67Putative far-red impaired response protein n=1 Tax... [more]
A0A6H5K2Y1_9PHAE1.570e-1778.85SWIM-type domain-containing protein n=1 Tax=Ectoca... [more]

Pages

back to top