prot_C-linearis_contig101.732.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig101.732.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 9
ZOOM
x 1
POSITION
0
MRSSNFLLSAALLIGSAIDVLGGANPVSVKVTLRGKKYDVKDATSVEDVRKSVEEQAGLAKEQQSVLFKGSLLKSELDLEEAGIADGDTVNIVPSKKPKAAASAADKGFAVGAGGDTEEVG102030405060708090100110120Expect = 6.11e-51 / Id = 83.33Expect = 9.31e-22 / Id = 54.29Expect = 2.68e-15 / Id = 42.74Expect = 8.48e-15 / Id = 46.39Expect = 2.46e-14 / Id = 50.67Expect = 4.42e-11 / Id = 44.90Expect = 3.46e-10 / Id = 47.06Expect = 4.23e-7 / Id = 40.70Expect = 7.94e-5 / Id = 39.19SequenceD8LE10_ECTSIA0A836CH29_9STRAW7T2R4_9STRAA0A7S2N0G5_9STRAA0A7S2WG81_9STRAB7G5I5_PHATCA0A7S2Y1L4_9STRAA0A448YZF6_9STRAA0A7S1D1N7_CYCTE
Match NameE-valueIdentityDescription
D8LE10_ECTSI6.110e-5183.33Ubiquitin-like domain-containing protein n=2 Tax=E... [more]
A0A836CH29_9STRA9.310e-2254.29Ubiquitin-like domain-containing protein n=1 Tax=T... [more]
W7T2R4_9STRA2.680e-1542.74Ubiquitin-like domain-containing protein n=2 Tax=M... [more]
A0A7S2N0G5_9STRA8.480e-1546.39Hypothetical protein n=1 Tax=Helicotheca tamesis T... [more]
A0A7S2WG81_9STRA2.460e-1450.67Hypothetical protein n=1 Tax=Rhizochromulina marin... [more]
B7G5I5_PHATC4.420e-1144.90Predicted protein n=3 Tax=Phaeodactylum tricornutu... [more]
A0A7S2Y1L4_9STRA3.460e-1047.06Hypothetical protein n=1 Tax=Fibrocapsa japonica T... [more]
A0A448YZF6_9STRA4.230e-740.70Ubiquitin-like domain-containing protein n=1 Tax=P... [more]
A0A7S1D1N7_CYCTE7.940e-539.19Hypothetical protein n=1 Tax=Cyclophora tenuis Tax... [more]
back to top