Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig10.501.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
| Match Name | E-value | Identity | Description | |
|---|
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR019734 | Tetratricopeptide repeat | SMART | SM00028 | tpr_5 | coord: 4..37
e-value: 12.0
score: 14.2
coord: 46..79
e-value: 11.0
score: 14.7 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 1..95
e-value: 1.2E-20
score: 75.7 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 3..75 |
| None | No IPR available | PFAM | PF13424 | TPR_12 | coord: 3..77
e-value: 1.3E-15
score: 57.4 |
| None | No IPR available | PANTHER | PTHR45783 | FAMILY NOT NAMED | coord: 3..139 |
| None | No IPR available | PANTHER | PTHR45783:SF3 | KINESIN LIGHT CHAIN | coord: 3..139 |
| IPR013026 | Tetratricopeptide repeat-containing domain | PROSITE | PS50293 | TPR_REGION | coord: 4..79
score: 8.722 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-linearis_contig10.501.1 ID=prot_C-linearis_contig10.501.1|Name=mRNA_C-linearis_contig10.501.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=155bp
MKTAHTLHQLGACAQEAGKLVEAEELLRRCLSIKEAKLDPEDIGVARTVN
QLGVCVREAGRLQEAEGYFRRCLGIVESKLGLDDGKMAITVSVQRGGRQF
EWLEKAHDLLNQYLEIGEAGRGCESRGVDEDLQQLSLCLREIRKFTRHLR
YLKIW back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|