mRNA_C-linearis_contig103.831.1 (mRNA) Chordaria linearis ClinC8C monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_C-linearis_contig103.831.1 vs. uniprot
Match: A0A6H5K479_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K479_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 1.400e-6 Identity = 23/26 (88.46%), Postives = 24/26 (92.31%), Query Frame = 3 Query: 255 ISRHPVGLFSLAFFPRRFFPPPSRPV 332 +SRH VGLFSLAFFPRRF PPPSRPV Sbjct: 1 MSRHAVGLFSLAFFPRRFLPPPSRPV 26 The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig103.831.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-linearis_contig103.831.1 >prot_C-linearis_contig103.831.1 ID=prot_C-linearis_contig103.831.1|Name=mRNA_C-linearis_contig103.831.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=111bp VRSTQYKQLIQTACAWRHTDFAWVIAQFPTAAASKPSKLGVAGSQAAKRFback to top mRNA from alignment at C-linearis_contig103:228762..229096+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-linearis_contig103.831.1 ID=mRNA_C-linearis_contig103.831.1|Name=mRNA_C-linearis_contig103.831.1|organism=Chordaria linearis ClinC8C monoicous|type=mRNA|length=335bp|location=Sequence derived from alignment at C-linearis_contig103:228762..229096+ (Chordaria linearis ClinC8C monoicous)back to top Coding sequence (CDS) from alignment at C-linearis_contig103:228762..229096+ >mRNA_C-linearis_contig103.831.1 ID=mRNA_C-linearis_contig103.831.1|Name=mRNA_C-linearis_contig103.831.1|organism=Chordaria linearis ClinC8C monoicous|type=CDS|length=666bp|location=Sequence derived from alignment at C-linearis_contig103:228762..229096+ (Chordaria linearis ClinC8C monoicous)back to top |