mRNA_C-linearis_contig10.533.1 (mRNA) Chordaria linearis ClinC8C monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_C-linearis_contig10.533.1 vs. uniprot
Match: D7FZW0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZW0_ECTSI) HSP 1 Score: 82.4 bits (202), Expect = 7.310e-16 Identity = 39/48 (81.25%), Postives = 45/48 (93.75%), Query Frame = -3 Query: 41 RDGEEELEYSSLSSVRVVRGPSLAELEKRKEALHKWSSLGPGGGIFAG 184 R+GEEELEYSSL++VRVVRGPS+ ELEKRK+ALHKW+SLGPGGGI G Sbjct: 367 REGEEELEYSSLANVRVVRGPSMGELEKRKQALHKWNSLGPGGGILGG 414
BLAST of mRNA_C-linearis_contig10.533.1 vs. uniprot
Match: A0A6H5L4H0_9PHAE (Coilin n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4H0_9PHAE) HSP 1 Score: 79.0 bits (193), Expect = 1.290e-14 Identity = 38/49 (77.55%), Postives = 45/49 (91.84%), Query Frame = -3 Query: 38 RDGEEELEYSSLSSVRVVRGPSLAELEKRKEALHKWSSLGPGGGIFAGS 184 R+GEEELEYSSL++VRVVRGPS+ EL+KRK+AL KW+SLGPGGGI GS Sbjct: 828 REGEEELEYSSLANVRVVRGPSMGELKKRKQALQKWNSLGPGGGILGGS 876 The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig10.533.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-linearis_contig10.533.1 >prot_C-linearis_contig10.533.1 ID=prot_C-linearis_contig10.533.1|Name=mRNA_C-linearis_contig10.533.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=125bp RRRWHSSLHPRPPTPRRCHRRAPVSSTCGAPPCASPARPARGPARRERSRback to top mRNA from alignment at C-linearis_contig10:2022639..2023013+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-linearis_contig10.533.1 ID=mRNA_C-linearis_contig10.533.1|Name=mRNA_C-linearis_contig10.533.1|organism=Chordaria linearis ClinC8C monoicous|type=mRNA|length=375bp|location=Sequence derived from alignment at C-linearis_contig10:2022639..2023013+ (Chordaria linearis ClinC8C monoicous)back to top Coding sequence (CDS) from alignment at C-linearis_contig10:2022639..2023013+ >mRNA_C-linearis_contig10.533.1 ID=mRNA_C-linearis_contig10.533.1|Name=mRNA_C-linearis_contig10.533.1|organism=Chordaria linearis ClinC8C monoicous|type=CDS|length=750bp|location=Sequence derived from alignment at C-linearis_contig10:2022639..2023013+ (Chordaria linearis ClinC8C monoicous)back to top |