prot_A-nodosum_M_contig9845.2.2 (polypeptide) Ascophyllum nodosum dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: D8LD43_ECTSI (Small nuclear ribonucleoprotein E n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LD43_ECTSI) HSP 1 Score: 70.9 bits (172), Expect = 5.520e-15 Identity = 35/38 (92.11%), Postives = 37/38 (97.37%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLDEAEEVDMK+DERK+LGRIMLKGDTITLMQSV Sbjct: 58 YMNLVLDEAEEVDMKNDERKQLGRIMLKGDTITLMQSV 95
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: A0A672ZVX5_9TELE (Small nuclear ribonucleoprotein E n=1 Tax=Sphaeramia orbicularis TaxID=375764 RepID=A0A672ZVX5_9TELE) HSP 1 Score: 58.2 bits (139), Expect = 1.890e-10 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEEV MK+ RK LGRIMLKGD ITL+QSV Sbjct: 12 YMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSV 49
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: A0A665WPI4_ECHNA (Small nuclear ribonucleoprotein E n=1 Tax=Echeneis naucrates TaxID=173247 RepID=A0A665WPI4_ECHNA) HSP 1 Score: 58.2 bits (139), Expect = 2.070e-10 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEEV MK+ RK LGRIMLKGD ITL+QSV Sbjct: 16 YMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSV 53
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: A0A8D3B629_SCOMX (Small nuclear ribonucleoprotein E n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A8D3B629_SCOMX) HSP 1 Score: 58.2 bits (139), Expect = 2.500e-10 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEEV MK+ RK LGRIMLKGD ITL+QSV Sbjct: 24 YMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSV 61
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: A0A4W6FIC7_LATCA (Small nuclear ribonucleoprotein E n=1 Tax=Lates calcarifer TaxID=8187 RepID=A0A4W6FIC7_LATCA) HSP 1 Score: 58.2 bits (139), Expect = 2.750e-10 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEEV MK+ RK LGRIMLKGD ITL+QSV Sbjct: 28 YMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSV 65
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: A0A673WRP4_SALTR (Small nuclear ribonucleoprotein E n=2 Tax=Euteleosteomorpha TaxID=1489388 RepID=A0A673WRP4_SALTR) HSP 1 Score: 58.2 bits (139), Expect = 2.890e-10 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEEV MK+ RK LGRIMLKGD ITL+QSV Sbjct: 30 YMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSV 67
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: A0A803K769_XENTR (Small nuclear ribonucleoprotein E n=1 Tax=Xenopus tropicalis TaxID=8364 RepID=A0A803K769_XENTR) HSP 1 Score: 57.8 bits (138), Expect = 2.950e-10 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEE+ +K+ RK+LGRIMLKGD ITL+QSV Sbjct: 16 YMNLVLDDAEEIHLKTKSRKQLGRIMLKGDNITLLQSV 53
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: A0A3Q1HH70_ANATE (Small nuclear ribonucleoprotein E n=1 Tax=Anabas testudineus TaxID=64144 RepID=A0A3Q1HH70_ANATE) HSP 1 Score: 58.2 bits (139), Expect = 2.960e-10 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEEV MK+ RK LGRIMLKGD ITL+QSV Sbjct: 31 YMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSV 68
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: A0A140LG21_DANRE (Small nuclear ribonucleoprotein E n=28 Tax=Clupeocephala TaxID=186625 RepID=A0A140LG21_DANRE) HSP 1 Score: 58.2 bits (139), Expect = 3.030e-10 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEEV MK+ RK LGRIMLKGD ITL+QSV Sbjct: 32 YMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSV 69
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Match: UPI0018F29080 (small nuclear ribonucleoprotein E n=2 Tax=Scyliorhinus canicula TaxID=7830 RepID=UPI0018F29080) HSP 1 Score: 58.5 bits (140), Expect = 3.550e-10 Identity = 28/38 (73.68%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 YTNLVLDEAEEVDMKSDERKELGRIMLKGDTITLMQSV 38 Y NLVLD+AEE+ MKS RK LGR+MLKGD ITL+QSV Sbjct: 53 YMNLVLDDAEEIHMKSKSRKPLGRVMLKGDNITLLQSV 90 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig9845.2.2 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig9845.2.2 ID=prot_A-nodosum_M_contig9845.2.2|Name=mRNA_A-nodosum_M_contig9845.2.2|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=39bpback to top |