prot_A-nodosum_M_contig98.35.1 (polypeptide) Ascophyllum nodosum dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5KWL9_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWL9_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 4.560e-9 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R +RI LY+C IDL KAYDSVDR LL Sbjct: 48 MLFVVRRLQELGRRRRIPLYMCFIDLQKAYDSVDRELL 85
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5KZG0_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZG0_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 7.680e-9 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R +RI LY+C IDL KAYDSVDR LL Sbjct: 72 MLFVVRRLQELGRRRRIPLYMCFIDLQKAYDSVDRELL 109
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5K856_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K856_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 8.550e-9 Identity = 26/38 (68.42%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R K+I LY+C +DL KAYDSVDR +L Sbjct: 1 MLFVLRRLQELGRRKKIPLYMCFVDLNKAYDSVDREML 38
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5L5Y6_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5Y6_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 1.540e-8 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R +RI LY+C IDL KAYDSVDR LL Sbjct: 84 MLFVVRRLQELGRRRRIPLYMCFIDLQKAYDSVDRELL 121
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5KQ53_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQ53_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 1.590e-8 Identity = 27/38 (71.05%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R K+I LY+C +DL KAYDSVDR LL Sbjct: 59 MLFVVRRLQELGRRKKIPLYMCFVDLNKAYDSVDRQLL 96
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5J6Q0_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J6Q0_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 1.720e-8 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R +RI LY+C IDL KAYDSVDR LL Sbjct: 87 MLFVVRRLQELGRRRRIPLYMCFIDLQKAYDSVDRELL 124
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5JE46_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JE46_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 2.490e-8 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R +RI LY+C IDL KAYDSVDR LL Sbjct: 98 MLFVVRRLQELGRRRRIPLYMCFIDLQKAYDSVDRELL 135
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5KLC1_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KLC1_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 3.390e-8 Identity = 26/38 (68.42%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R K+I LY+C +DL KAYDSVDR +L Sbjct: 125 MLFVVRRLQELGRRKKIPLYMCFVDLNKAYDSVDREML 162
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5KT29_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KT29_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 3.420e-8 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R +RI LY+C IDL KAYDSVDR LL Sbjct: 155 MLFVVRRLQELGRRRRIPLYMCFIDLQKAYDSVDRELL 192
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Match: A0A6H5K615_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K615_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 3.660e-8 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MLFVIRRLPELAREKRISLYICLIDLTKAYDSVDRTLL 38 MLFV+RRL EL R +RI LY+C IDL KAYDSVDR LL Sbjct: 153 MLFVVRRLQELGRRRRIPLYMCFIDLQKAYDSVDRELL 190 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig98.35.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig98.35.1 ID=prot_A-nodosum_M_contig98.35.1|Name=mRNA_A-nodosum_M_contig98.35.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=53bpback to top |