prot_A-nodosum_M_contig10207.1.1 (polypeptide) Ascophyllum nodosum dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JYE2_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYE2_9PHAE) HSP 1 Score: 69.3 bits (168), Expect = 7.990e-13 Identity = 32/58 (55.17%), Postives = 42/58 (72.41%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 +R RRLL+AG+L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 63 IRQRRLLFAGSLARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 120
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JAH7_9PHAE (Reverse transcriptase domain-containing protein n=5 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAH7_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 2.450e-12 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 +R RRLL+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 195 IRQRRLLFAGALARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 252
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JFE2_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFE2_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 5.640e-12 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 +R RRLL+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 325 IRQRRLLFAGALARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 382
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JLT1_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLT1_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 5.690e-12 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 +R RRLL+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 458 IRQRRLLFAGALARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 515
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5KS82_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS82_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.070e-11 Identity = 32/58 (55.17%), Postives = 40/58 (68.97%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 +R RRLL+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D+ AFG + Sbjct: 547 IRQRRLLFAGALARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLNAFGAD 604
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5K1X4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K1X4_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 3.700e-11 Identity = 31/58 (53.45%), Postives = 40/58 (68.97%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 +R RRLL+AG L R GRLPKR+M G L G +R RGG+E+ W CV D++AFG + Sbjct: 219 IRQRRLLFAGALARQPDGRLPKRLMLGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 276
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5K2V9_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2V9_9PHAE) HSP 1 Score: 63.9 bits (154), Expect = 3.280e-10 Identity = 28/52 (53.85%), Postives = 36/52 (69.23%), Query Frame = 0 Query: 8 LWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 L+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 287 LFAGALARQPDGRLPKRLMFGELAGGEKRSRGGQEQNWPKCVLDDLKAFGAD 338
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5KQ16_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQ16_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 1.210e-9 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIR 54 +R RR+L+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++ Sbjct: 195 IRQRRILFAGALTRQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLK 247
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5K2V4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2V4_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 3.540e-9 Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 +R RRLL A L R GRLPKR+M G L G +R RGG+++ W CV D++AFG + Sbjct: 175 IRQRRLLLARALARQPDGRLPKRLMLGELAGGEKRRRGGQKQNWPKCVLDDLKAFGAD 232
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JTZ8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JTZ8_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 9.140e-9 Identity = 27/58 (46.55%), Postives = 38/58 (65.52%), Query Frame = 0 Query: 2 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 59 +R RRLL+AG + R GRLPKR++ G L G +R G+E+ W CV D++AFG + Sbjct: 176 IRQRRLLFAGAMARQPDGRLPKRLVLGELAGGEKRRSAGQEQNWPKCVLDDLKAFGAD 233 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig10207.1.1 ID=prot_A-nodosum_M_contig10207.1.1|Name=mRNA_A-nodosum_M_contig10207.1.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=72bpback to top |