mRNA_A-nodosum_M_contig10207.1.1 (mRNA) Ascophyllum nodosum dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JYE2_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYE2_9PHAE) HSP 1 Score: 69.3 bits (168), Expect = 7.990e-13 Identity = 32/58 (55.17%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 +R RRLL+AG+L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 63 IRQRRLLFAGSLARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 120
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JAH7_9PHAE (Reverse transcriptase domain-containing protein n=5 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAH7_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 2.450e-12 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 +R RRLL+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 195 IRQRRLLFAGALARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 252
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JFE2_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFE2_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 5.640e-12 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 +R RRLL+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 325 IRQRRLLFAGALARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 382
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JLT1_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLT1_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 5.690e-12 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 +R RRLL+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 458 IRQRRLLFAGALARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 515
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5KS82_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS82_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.070e-11 Identity = 32/58 (55.17%), Postives = 40/58 (68.97%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 +R RRLL+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D+ AFG + Sbjct: 547 IRQRRLLFAGALARQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLNAFGAD 604
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5K1X4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K1X4_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 3.700e-11 Identity = 31/58 (53.45%), Postives = 40/58 (68.97%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 +R RRLL+AG L R GRLPKR+M G L G +R RGG+E+ W CV D++AFG + Sbjct: 219 IRQRRLLFAGALARQPDGRLPKRLMLGELAGGEKRRRGGQEQNWPKCVLDDLKAFGAD 276
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5K2V9_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2V9_9PHAE) HSP 1 Score: 63.9 bits (154), Expect = 3.280e-10 Identity = 28/52 (53.85%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 22 LWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 L+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++AFG + Sbjct: 287 LFAGALARQPDGRLPKRLMFGELAGGEKRSRGGQEQNWPKCVLDDLKAFGAD 338
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5KQ16_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQ16_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 1.210e-9 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIR 162 +R RR+L+AG L R GRLPKR+MFG L G +R RGG+E+ W CV D++ Sbjct: 195 IRQRRILFAGALTRQPDGRLPKRLMFGELAGGEKRRRGGQEQNWPKCVLDDLK 247
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5K2V4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2V4_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 3.540e-9 Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 +R RRLL A L R GRLPKR+M G L G +R RGG+++ W CV D++AFG + Sbjct: 175 IRQRRLLLARALARQPDGRLPKRLMLGELAGGEKRRRGGQKQNWPKCVLDDLKAFGAD 232
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Match: A0A6H5JTZ8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JTZ8_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 9.140e-9 Identity = 27/58 (46.55%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 4 LRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQSDIRAFGIN 177 +R RRLL+AG + R GRLPKR++ G L G +R G+E+ W CV D++AFG + Sbjct: 176 IRQRRLLFAGAMARQPDGRLPKRLVLGELAGGEKRRSAGQEQNWPKCVLDDLKAFGAD 233 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig10207.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_A-nodosum_M_contig10207.1.1 >prot_A-nodosum_M_contig10207.1.1 ID=prot_A-nodosum_M_contig10207.1.1|Name=mRNA_A-nodosum_M_contig10207.1.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=72bp MLRTRRLLWAGTLLRMSGGRLPKRIMFGNLEGAVRRGRGGKEKEWTDCVQback to top mRNA from alignment at A-nodosum_M_contig10207:7668..7883- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_A-nodosum_M_contig10207.1.1 ID=mRNA_A-nodosum_M_contig10207.1.1|Name=mRNA_A-nodosum_M_contig10207.1.1|organism=Ascophyllum nodosum dioecious|type=mRNA|length=216bp|location=Sequence derived from alignment at A-nodosum_M_contig10207:7668..7883- (Ascophyllum nodosum dioecious)back to top Coding sequence (CDS) from alignment at A-nodosum_M_contig10207:7668..7883- >mRNA_A-nodosum_M_contig10207.1.1 ID=mRNA_A-nodosum_M_contig10207.1.1|Name=mRNA_A-nodosum_M_contig10207.1.1|organism=Ascophyllum nodosum dioecious|type=CDS|length=216bp|location=Sequence derived from alignment at A-nodosum_M_contig10207:7668..7883- (Ascophyllum nodosum dioecious)back to top |