mRNA_A-nodosum_M_contig10081.1.1 (mRNA) Ascophyllum nodosum dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: D7FH66_ECTSI (RNA-binding S4 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH66_ECTSI) HSP 1 Score: 60.8 bits (146), Expect = 1.650e-10 Identity = 28/35 (80.00%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMART 105 V+EGDIVTVRGKGRVE+ ITVTKKGRYK++M RT Sbjct: 123 VREGDIVTVRGKGRVEIGDITVTKKGRYKINMCRT 157
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: A0A6H5J7Q1_9PHAE (S4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J7Q1_9PHAE) HSP 1 Score: 61.2 bits (147), Expect = 5.890e-10 Identity = 28/35 (80.00%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMART 105 VKEGD+VTVRGKGRVE+ ITVTKKGRYK++M RT Sbjct: 292 VKEGDVVTVRGKGRVEIGDITVTKKGRYKINMRRT 326
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: A0A7C9PSN9_9CYAN (Photosystem II S4 domain protein n=1 Tax=Oscillatoria sp. SIO1A7 TaxID=2607767 RepID=A0A7C9PSN9_9CYAN) HSP 1 Score: 52.0 bits (123), Expect = 1.030e-6 Identity = 22/34 (64.71%), Postives = 28/34 (82.35%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMAR 102 VK GD++ +RGKGR+EV IT+TKKGRY+V M R Sbjct: 224 VKSGDLIAIRGKGRLEVGEITITKKGRYRVQMTR 257
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: A0A0M1JYR8_9CYAN (RNA-binding protein n=1 Tax=Planktothricoides sp. SR001 TaxID=1705388 RepID=A0A0M1JYR8_9CYAN) HSP 1 Score: 51.2 bits (121), Expect = 1.950e-6 Identity = 22/34 (64.71%), Postives = 28/34 (82.35%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMAR 102 VK D++ +RGKGR+EV ITVTKKGRY+VD+ R Sbjct: 224 VKSNDLIAIRGKGRLEVGEITVTKKGRYRVDLTR 257
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: A0A7S3UWV6_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UWV6_HETAK) HSP 1 Score: 49.3 bits (116), Expect = 5.930e-6 Identity = 22/32 (68.75%), Postives = 27/32 (84.38%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDM 96 VKEGD+VTVRGKGRVE++ I T KGR++V M Sbjct: 145 VKEGDVVTVRGKGRVEILEIAKTAKGRFRVTM 176
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: A0A350YAT2_9CYAN (Photosystem II S4 domain protein n=1 Tax=Cyanobacteria bacterium UBA11370 TaxID=2055769 RepID=A0A350YAT2_9CYAN) HSP 1 Score: 49.7 bits (117), Expect = 7.050e-6 Identity = 21/36 (58.33%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMARTM 108 VK GD++ +RGKGR+EV +TVTKK RY+V + R M Sbjct: 224 VKSGDLIAIRGKGRLEVGEVTVTKKDRYRVQLTRLM 259
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: A0A6P0SBI0_9CYAN (Photosystem II S4 domain protein (Fragment) n=1 Tax=Moorena sp. SIO2I5 TaxID=2607825 RepID=A0A6P0SBI0_9CYAN) HSP 1 Score: 48.5 bits (114), Expect = 1.040e-5 Identity = 19/34 (55.88%), Postives = 28/34 (82.35%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMAR 102 VK GD++ +RGKGR+EV +++TKK RY+VD+ R Sbjct: 135 VKSGDLIAIRGKGRLEVGDVSITKKQRYRVDLTR 168
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: A0A2P6TLW0_CHLSO (Photosystem II S4 domain n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TLW0_CHLSO) HSP 1 Score: 48.9 bits (115), Expect = 1.120e-5 Identity = 21/34 (61.76%), Postives = 28/34 (82.35%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMAR 102 VK GD+++V GKGR+EV G ++TKKG+Y V MAR Sbjct: 182 VKAGDVISVAGKGRLEVRGASMTKKGKYSVQMAR 215
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: UPI0019ED3DDA (Photosystem II S4 domain protein n=1 Tax=Pleurocapsales cyanobacterium LEGE 10410 TaxID=1828828 RepID=UPI0019ED3DDA) HSP 1 Score: 48.9 bits (115), Expect = 1.330e-5 Identity = 21/34 (61.76%), Postives = 29/34 (85.29%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMAR 102 VKEGD++ VRGKGR+EV ++VTKK RY+V++ R Sbjct: 223 VKEGDLIAVRGKGRLEVGEVSVTKKQRYRVNLVR 256
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Match: A0A563VPY8_9CYAN (Photosystem II S4 domain protein n=1 Tax=Hyella patelloides LEGE 07179 TaxID=945734 RepID=A0A563VPY8_9CYAN) HSP 1 Score: 48.9 bits (115), Expect = 1.340e-5 Identity = 21/34 (61.76%), Postives = 29/34 (85.29%), Query Frame = 1 Query: 1 VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMAR 102 VK GD+++VRGKGR+EV ++VTKK RY+VD+ R Sbjct: 224 VKAGDLISVRGKGRLEVGEVSVTKKQRYRVDLVR 257 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig10081.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_A-nodosum_M_contig10081.1.1 >prot_A-nodosum_M_contig10081.1.1 ID=prot_A-nodosum_M_contig10081.1.1|Name=mRNA_A-nodosum_M_contig10081.1.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=37bp VKEGDIVTVRGKGRVEVVGITVTKKGRYKVDMARTM*back to top mRNA from alignment at A-nodosum_M_contig10081:4874..4984+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_A-nodosum_M_contig10081.1.1 ID=mRNA_A-nodosum_M_contig10081.1.1|Name=mRNA_A-nodosum_M_contig10081.1.1|organism=Ascophyllum nodosum dioecious|type=mRNA|length=111bp|location=Sequence derived from alignment at A-nodosum_M_contig10081:4874..4984+ (Ascophyllum nodosum dioecious)back to top Coding sequence (CDS) from alignment at A-nodosum_M_contig10081:4874..4984+ >mRNA_A-nodosum_M_contig10081.1.1 ID=mRNA_A-nodosum_M_contig10081.1.1|Name=mRNA_A-nodosum_M_contig10081.1.1|organism=Ascophyllum nodosum dioecious|type=CDS|length=111bp|location=Sequence derived from alignment at A-nodosum_M_contig10081:4874..4984+ (Ascophyllum nodosum dioecious)back to top |