mRNA_13905 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|13037 vs. uniprot
Match: A0A836CLC7_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CLC7_9STRA) HSP 1 Score: 95.5 bits (236), Expect = 5.630e-22 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 3 Query: 261 TEASPLIPTAYAVPLLPDEPEYTLTTEAAAFEPEQIKPSAPPKDAKR 401 TEASPLIPTAYAVPLLPDEPEYTLTTEAAAFEPEQIKPSAPPKDAKR Sbjct: 77 TEASPLIPTAYAVPLLPDEPEYTLTTEAAAFEPEQIKPSAPPKDAKR 123 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|13037 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_13905 ID=mRNA_13905|Name=jgi.p|Trimin1|13037|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=582bp|location=Sequence derived from alignment at Contig_122:79959..81289+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. CTGAAATTCAACTGGAGCACAGATCGAGGATCATGTTTGTCGTCATCGCTback to top protein sequence of jgi.p|Trimin1|13037 >Trimin1|13037|CE13036_116 ID=Trimin1|13037|CE13036_116|Name=jgi.p|Trimin1|13037|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=124bp MFVVIALVFIIVMVMCCCCCGCGCEPIAMGVVGAGAVALGVSKRRSAKKDback to top mRNA from alignment at Contig_122:79959..81289+ Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_13905 ID=mRNA_13905|Name=jgi.p|Trimin1|13037|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=1331bp|location=Sequence derived from alignment at Contig_122:79959..81289+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_122:79959..81289+ >mRNA_13905 ID=mRNA_13905|Name=jgi.p|Trimin1|13037|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=372bp|location=Sequence derived from alignment at Contig_122:79959..81289+ (Tribonema minus UTEX_B_3156 )back to top |