Trimin1|149960|gw1.111.82.1 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|149960 vs. uniprot
Match: A0A835ZGH9_9STRA (Uncharacterized protein (Fragment) n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZGH9_9STRA) HSP 1 Score: 96.7 bits (239), Expect = 8.890e-21 Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 0 Query: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCGDC 40 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCGDC Sbjct: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTHCGDC 40
BLAST of jgi.p|Trimin1|149960 vs. uniprot
Match: A0A835ZBE1_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBE1_9STRA) HSP 1 Score: 80.1 bits (196), Expect = 1.030e-13 Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTH 36 CREHKTGDMQDV+HKRCM+C LKIPKFGTEDGRPTH Sbjct: 372 CREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 407
BLAST of jgi.p|Trimin1|149960 vs. uniprot
Match: A0A836CCS5_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CCS5_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 1.830e-8 Identity = 26/36 (72.22%), Postives = 28/36 (77.78%), Query Frame = 0 Query: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTH 36 C +HKTGDMQDV+HK C C LKIP FG EDG PTH Sbjct: 15 CSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH 50 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|149960 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|149960|gw1.111.82.1 ID=Trimin1|149960|gw1.111.82.1|Name=jgi.p|Trimin1|149960|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=233bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|