Trimin1|350871|estExt_Genemark1.C_Ctg_740064 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|350871 vs. uniprot
Match: A0A835YLT8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YLT8_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 1.840e-13 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = 0 Query: 1 MARFLVGIPCPEGMGMYGSVPAPLVRALLLS 31 MARFLVGIPCPEGMGMYGSVPAPLVRALLLS Sbjct: 1 MARFLVGIPCPEGMGMYGSVPAPLVRALLLS 31
BLAST of jgi.p|Trimin1|350871 vs. uniprot
Match: A0A835YKK7_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YKK7_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 1.390e-9 Identity = 27/29 (93.10%), Postives = 28/29 (96.55%), Query Frame = 0 Query: 3 RFLVGIPCPEGMGMYGSVPAPLVRALLLS 31 RFLVG+PCPEGMGMYGSVPAPLVRALL S Sbjct: 1795 RFLVGVPCPEGMGMYGSVPAPLVRALLFS 1823 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|350871 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|350871|estExt_Genemark1.C_Ctg_740064 ID=Trimin1|350871|estExt_Genemark1.C_Ctg_740064|Name=jgi.p|Trimin1|350871|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=61bpback to top |