Trimin1|132860|gw1.18.65.1 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|132860 vs. uniprot
Match: A0A835ZEH2_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZEH2_9STRA) HSP 1 Score: 87.8 bits (216), Expect = 1.230e-18 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 0 Query: 1 CECGKARPSFGFEGDDRATCCALCKADNMTDIKKRRCV 38 CECGKARPSFGFEGDDRATCCALCKADNMTDIKKRRCV Sbjct: 1 CECGKARPSFGFEGDDRATCCALCKADNMTDIKKRRCV 38
BLAST of jgi.p|Trimin1|132860 vs. uniprot
Match: A0A813F4K6_POLGL (Hypothetical protein n=1 Tax=Polarella glacialis TaxID=89957 RepID=A0A813F4K6_POLGL) HSP 1 Score: 54.3 bits (129), Expect = 5.400e-6 Identity = 22/32 (68.75%), Postives = 25/32 (78.12%), Query Frame = 0 Query: 1 CECGKARPSFGFEGDDRATCCALCKADNMTDI 32 C CG+ RPSFGF GD RATCC+ CKA+ M DI Sbjct: 26 CTCGQRRPSFGFPGDARATCCSQCKAEYMVDI 57
BLAST of jgi.p|Trimin1|132860 vs. uniprot
Match: A0A835Z0G3_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z0G3_9STRA) HSP 1 Score: 54.7 bits (130), Expect = 7.040e-6 Identity = 21/29 (72.41%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 1 CECGKARPSFGFEGDDRATCCALCKADNM 29 C CGK++PSFG E D+RATCCALCK+D+M Sbjct: 9 CSCGKSQPSFGVEEDERATCCALCKSDDM 37 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|132860 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|132860|gw1.18.65.1 ID=Trimin1|132860|gw1.18.65.1|Name=jgi.p|Trimin1|132860|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=175bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|