mRNA_9493 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|151063 vs. uniprot
Match: A0A836CMN5_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CMN5_9STRA) HSP 1 Score: 89.7 bits (221), Expect = 3.570e-19 Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 1 Query: 1 QRLCSTGCGRRAALERPGEPGVLYCRQCGGAQAVDVTHAK 120 QRLCSTGCGRRAALERPGEPGVLYCRQCGGAQAVDVTHAK Sbjct: 1 QRLCSTGCGRRAALERPGEPGVLYCRQCGGAQAVDVTHAK 40 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|151063 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_9493 ID=mRNA_9493|Name=jgi.p|Trimin1|151063|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=552bp|location=Sequence derived from alignment at Contig_106:101125..101676+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. CAGCGTTTGTGTTCTACAGGCTGCGGCAGACGCGCCGCGTTGGAACGACCback to top protein sequence of jgi.p|Trimin1|151063 >Trimin1|151063|gw1.106.73.1 ID=Trimin1|151063|gw1.106.73.1|Name=jgi.p|Trimin1|151063|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=184bp QRLCSTGCGRRAALERPGEPGVLYCRQCGGAQAVDVTHAKCAGGCGKRPHback to top mRNA from alignment at Contig_106:101125..101676+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_9493 ID=mRNA_9493|Name=jgi.p|Trimin1|151063|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=552bp|location=Sequence derived from alignment at Contig_106:101125..101676+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_106:101125..101676+ >mRNA_9493 ID=mRNA_9493|Name=jgi.p|Trimin1|151063|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=552bp|location=Sequence derived from alignment at Contig_106:101125..101676+ (Tribonema minus UTEX_B_3156 )back to top |