mRNA_9326 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|146722 vs. uniprot
Match: A0A836CCS5_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CCS5_9STRA) HSP 1 Score: 117 bits (293), Expect = 2.230e-28 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1 Query: 1 KAPSYNVPGVGAQWCSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH 150 KAPSYNVPGVGAQWCSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH Sbjct: 1 KAPSYNVPGVGAQWCSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH 50
BLAST of jgi.p|Trimin1|146722 vs. uniprot
Match: A0A835ZBE1_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBE1_9STRA) HSP 1 Score: 93.6 bits (231), Expect = 3.180e-18 Identity = 38/50 (76.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 1 KAPSYNVPGVGAQWCSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH 150 KAP YN+PG AQWC +HKTGDMQDVAHK C CGLKIP FG EDG PTH Sbjct: 358 KAPIYNIPGAAAQWCREHKTGDMQDVAHKRCMRCGLKIPKFGTEDGRPTH 407
BLAST of jgi.p|Trimin1|146722 vs. uniprot
Match: A0A835ZGH9_9STRA (Uncharacterized protein (Fragment) n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZGH9_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 1.420e-8 Identity = 26/36 (72.22%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 43 CSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTH 150 C +HKTGDMQDV+HK C C LKIP FG EDG PTH Sbjct: 1 CREHKTGDMQDVSHKRCMQCRLKIPKFGTEDGRPTH 36 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|146722 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_9326 ID=mRNA_9326|Name=jgi.p|Trimin1|146722|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=744bp|location=Sequence derived from alignment at Contig_38:713692..714435- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. AAGGCGCCGTCCTACAACGTCCCTGGGGTAGGAGCACAGTGGTGCTCGGAback to top protein sequence of jgi.p|Trimin1|146722 >Trimin1|146722|gw1.38.112.1 ID=Trimin1|146722|gw1.38.112.1|Name=jgi.p|Trimin1|146722|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=248bp KAPSYNVPGVGAQWCSDHKTGDMQDVAHKMCQGCGLKIPIFGIEDGSPTHback to top mRNA from alignment at Contig_38:713692..714435- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_9326 ID=mRNA_9326|Name=jgi.p|Trimin1|146722|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=744bp|location=Sequence derived from alignment at Contig_38:713692..714435- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_38:713692..714435- >mRNA_9326 ID=mRNA_9326|Name=jgi.p|Trimin1|146722|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=744bp|location=Sequence derived from alignment at Contig_38:713692..714435- (Tribonema minus UTEX_B_3156 )back to top |