mRNA_7613 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: A0A835YK20_9STRA (DnaJ domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YK20_9STRA) HSP 1 Score: 105 bits (262), Expect = 5.280e-29 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1 Query: 1 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAANVRIS 153 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAANVRIS Sbjct: 1 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAANVRIS 51
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: D7G3I7_ECTSI (Heat shock protein 40 like protein/ DnaJ domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3I7_ECTSI) HSP 1 Score: 68.9 bits (167), Expect = 2.360e-12 Identity = 31/47 (65.96%), Postives = 39/47 (82.98%), Query Frame = 1 Query: 1 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAAN 141 DPYL+LGV A + IKKAYRKLAL+YHPDKN+ T++LFQA+Q A+ Sbjct: 65 DPYLTLGVDPAADEGTIKKAYRKLALRYHPDKNKATSTLFQAVQGAH 111
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: A0A482SP57_9ARCH (J domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SP57_9ARCH) HSP 1 Score: 60.5 bits (145), Expect = 4.030e-11 Identity = 29/48 (60.42%), Postives = 35/48 (72.92%), Query Frame = 1 Query: 4 PYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAANVR 147 P+ LGV +A D++KAY+KLALKYHPDKN T LFQ IQ+AN R Sbjct: 6 PFDVLGVNTEARTVDVRKAYKKLALKYHPDKNPKTTPLFQVIQSANSR 53
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: A0A7S1G6Z7_9STRA (Hypothetical protein (Fragment) n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1G6Z7_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 1.550e-10 Identity = 29/51 (56.86%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 1 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAANVRIS 153 DPY LGV A N +KKAYR+LAL+YHPDKN T SLF+ + AA +S Sbjct: 75 DPYACLGVDSAATPNVVKKAYRRLALRYHPDKNHHTESLFKTVSAAYALVS 125
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: A0A1G0WXQ3_9GAMM (Chaperone protein DnaJ n=1 Tax=Legionellales bacterium RIFCSPHIGHO2_12_FULL_37_14 TaxID=1798568 RepID=A0A1G0WXQ3_9GAMM) HSP 1 Score: 60.8 bits (146), Expect = 1.620e-9 Identity = 31/49 (63.27%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 1 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASL---FQAIQAA 138 D Y LGVP DA D DIKKAYRKLA+KYHPD+N+G A+ F+ IQ+A Sbjct: 6 DYYTLLGVPRDASDADIKKAYRKLAMKYHPDRNQGDAAASEKFKEIQSA 54
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: A0A7S4A573_9STRA (Hypothetical protein n=2 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S4A573_9STRA) HSP 1 Score: 60.5 bits (145), Expect = 2.270e-9 Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = 1 Query: 4 PYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAA 138 PY +LG+ DA D IKKAYRKLALK HPDKN T LFQA++ A Sbjct: 61 PYGALGLTTDATDAQIKKAYRKLALKLHPDKNPKTTPLFQAVKTA 105
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: A0A183CJ76_GLOPA (J domain-containing protein n=1 Tax=Globodera pallida TaxID=36090 RepID=A0A183CJ76_GLOPA) HSP 1 Score: 56.6 bits (135), Expect = 2.690e-9 Identity = 28/50 (56.00%), Postives = 34/50 (68.00%), Query Frame = 1 Query: 7 YLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRG---TASLFQAIQAANVR 147 Y L VP DA D+DIK+AYR+LAL+YHPDKNR + FQ I AN + Sbjct: 29 YELLNVPKDATDDDIKRAYRRLALRYHPDKNRNDPEASKKFQEINYANAK 78
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: UPI0001FE2A65 (hypothetical protein n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=UPI0001FE2A65) HSP 1 Score: 60.1 bits (144), Expect = 3.100e-9 Identity = 30/47 (63.83%), Postives = 33/47 (70.21%), Query Frame = 1 Query: 1 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAAN 141 D Y +LGVP DA DIKKA+RKLA+KYHPDKN LFQ I AN Sbjct: 222 DYYEALGVPRDASAADIKKAFRKLAIKYHPDKNPEAKDLFQLINEAN 268
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: A0A524AS23_9CHLR (Molecular chaperone DnaJ (Fragment) n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A524AS23_9CHLR) HSP 1 Score: 54.7 bits (130), Expect = 5.970e-9 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 1 Query: 1 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRG 105 D Y SLGVP +A D DIKKAYRKLA++YHPD+N G Sbjct: 4 DYYGSLGVPRNASDGDIKKAYRKLAMQYHPDRNPG 38
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Match: A0A3D2X1B4_9BACT (Molecular chaperone DnaJ (Fragment) n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A3D2X1B4_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 6.360e-9 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 1 Query: 1 DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRG 105 D Y LGVP +A DND+KKAYRK+A+KYHPDKN G Sbjct: 6 DYYEILGVPRNATDNDLKKAYRKIAMKYHPDKNPG 40 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|151346 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_7613 ID=mRNA_7613|Name=jgi.p|Trimin1|151346|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=153bp|location=Sequence derived from alignment at Contig_75:198327..198479- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. GACCCGTACTTATCTCTGGGAGTGCCAGTTGATGCTCCAGACAACGACATback to top protein sequence of jgi.p|Trimin1|151346 >Trimin1|151346|gw1.75.155.1 ID=Trimin1|151346|gw1.75.155.1|Name=jgi.p|Trimin1|151346|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=51bp DPYLSLGVPVDAPDNDIKKAYRKLALKYHPDKNRGTASLFQAIQAANVRIback to top mRNA from alignment at Contig_75:198327..198479- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_7613 ID=mRNA_7613|Name=jgi.p|Trimin1|151346|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=153bp|location=Sequence derived from alignment at Contig_75:198327..198479- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_75:198327..198479- >mRNA_7613 ID=mRNA_7613|Name=jgi.p|Trimin1|151346|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=153bp|location=Sequence derived from alignment at Contig_75:198327..198479- (Tribonema minus UTEX_B_3156 )back to top |