mRNA_6125 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A835Z078_9STRA (Protein kinase domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z078_9STRA) HSP 1 Score: 143 bits (361), Expect = 9.140e-44 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF Sbjct: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 63
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A8K1C2E6_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1C2E6_PYTOL) HSP 1 Score: 115 bits (289), Expect = 1.240e-28 Identity = 43/63 (68.25%), Postives = 56/63 (88.89%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 ++W+A+Q+LRAL QCHA G+CHGD+K EN++VTSWNWV L DFAPFKPTY+P+D PA+ +YYF Sbjct: 135 KKWIAFQILRALEQCHAKGICHGDIKQENIMVTSWNWVFLTDFAPFKPTYIPEDDPADYNYYF 197
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: M4BGW9_HYAAE (Non-specific serine/threonine protein kinase n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4BGW9_HYAAE) HSP 1 Score: 115 bits (288), Expect = 1.690e-28 Identity = 45/63 (71.43%), Postives = 56/63 (88.89%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 ++W+A+QLLRALAQ HA G+CHGD+K ENV+VTSWNWV L DFAPFKPTY+P+D PA+ +YYF Sbjct: 135 KKWLAFQLLRALAQSHAKGICHGDIKQENVMVTSWNWVFLTDFAPFKPTYIPEDDPADYNYYF 197
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A2D4CEE2_PYTIN (Phosphoinositide 3-kinase regulatory subunit n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CEE2_PYTIN) HSP 1 Score: 114 bits (285), Expect = 4.290e-28 Identity = 41/63 (65.08%), Postives = 56/63 (88.89%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 ++W+A+Q+LRAL QCH+ G+CHGD+K EN++VTSWNW+ L DFAPFKPTY+P+D PA+ +YYF Sbjct: 135 KKWIAFQILRALEQCHSKGICHGDIKQENIMVTSWNWIFLTDFAPFKPTYIPEDDPADYNYYF 197
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A1W0A189_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1W0A189_9STRA) HSP 1 Score: 114 bits (285), Expect = 4.300e-28 Identity = 44/63 (69.84%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 R+W+A+QLL+AL QCH+ G+CHGD+K ENV+VTSWNW+ L DFAPFKPTY+P+D PAE YYF Sbjct: 143 RKWIAFQLLKALEQCHSKGICHGDIKQENVMVTSWNWIFLTDFAPFKPTYMPEDDPAEYYYYF 205
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A7S1CBY9_9STRA (Hypothetical protein (Fragment) n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1CBY9_9STRA) HSP 1 Score: 108 bits (270), Expect = 8.960e-28 Identity = 46/63 (73.02%), Postives = 54/63 (85.71%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 +RW+ +QLLRALAQCH AGV HGDVKSENVLVTSWNWVLL DFAPFKPT +P+D ++ Y+F Sbjct: 142 KRWITFQLLRALAQCHGAGVVHGDVKSENVLVTSWNWVLLTDFAPFKPTRLPEDDHSDFHYFF 204
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A0P1AGI3_PLAHL (Non-specific serine/threonine protein kinase n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1AGI3_PLAHL) HSP 1 Score: 112 bits (281), Expect = 1.490e-27 Identity = 44/63 (69.84%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 ++W+A+Q+LRAL Q HA G+CHGDVK ENV+VTSWNWV L DFAPFKPTY+P+D PA+ +YYF Sbjct: 135 KKWIAFQILRALEQSHAKGICHGDVKQENVMVTSWNWVFLTDFAPFKPTYIPEDDPADYNYYF 197
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A225X0L1_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225X0L1_9STRA) HSP 1 Score: 112 bits (280), Expect = 2.030e-27 Identity = 43/63 (68.25%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 ++W+A+Q+LRAL Q HA G+CHGD+K ENV+VTSWNWV L DFAPFKPTY+P+D PA+ +YYF Sbjct: 135 KKWIAFQILRALEQSHAKGICHGDIKQENVMVTSWNWVFLTDFAPFKPTYIPEDDPADYNYYF 197
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A0W8DI87_PHYNI (Non-specific serine/threonine protein kinase n=1 Tax=Phytophthora nicotianae TaxID=4790 RepID=A0A0W8DI87_PHYNI) HSP 1 Score: 112 bits (280), Expect = 2.030e-27 Identity = 43/63 (68.25%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 ++W+A+Q+LRAL Q HA G+CHGD+K ENV+VTSWNWV L DFAPFKPTY+P+D PA+ +YYF Sbjct: 135 KKWIAFQILRALEQSHAKGICHGDIKQENVMVTSWNWVFLTDFAPFKPTYIPEDDPADYNYYF 197
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Match: A0A6A3T4I0_9STRA (Non-specific serine/threonine protein kinase n=4 Tax=Phytophthora TaxID=4783 RepID=A0A6A3T4I0_9STRA) HSP 1 Score: 112 bits (280), Expect = 2.040e-27 Identity = 43/63 (68.25%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYVPDDQPAEVDYYF 189 ++W+A+Q+LRAL Q HA G+CHGD+K ENV+VTSWNWV L DFAPFKPTY+P+D PA+ +YYF Sbjct: 135 KKWIAFQILRALEQSHAKGICHGDIKQENVMVTSWNWVFLTDFAPFKPTYIPEDDPADYNYYF 197 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|148510 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_6125 ID=mRNA_6125|Name=jgi.p|Trimin1|148510|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=189bp|location=Sequence derived from alignment at Contig_45:701073..701261+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. CGCAGGTGGATGGCCTACCAGCTCCTGCGCGCGCTGGCGCAGTGCCACGCback to top protein sequence of jgi.p|Trimin1|148510 >Trimin1|148510|gw1.45.122.1 ID=Trimin1|148510|gw1.45.122.1|Name=jgi.p|Trimin1|148510|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=63bp RRWMAYQLLRALAQCHAAGVCHGDVKSENVLVTSWNWVLLCDFAPFKPTYback to top mRNA from alignment at Contig_45:701073..701261+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_6125 ID=mRNA_6125|Name=jgi.p|Trimin1|148510|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=189bp|location=Sequence derived from alignment at Contig_45:701073..701261+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_45:701073..701261+ >mRNA_6125 ID=mRNA_6125|Name=jgi.p|Trimin1|148510|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=189bp|location=Sequence derived from alignment at Contig_45:701073..701261+ (Tribonema minus UTEX_B_3156 )back to top |