mRNA_495 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: A0A835YXI8_9STRA (40S ribosomal protein S30 n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YXI8_9STRA) HSP 1 Score: 112 bits (280), Expect = 1.580e-31 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 1 Query: 1 MLISLNLSYLLQQVDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 174 MLISLNLSYLLQQVDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV Sbjct: 1 MLISLNLSYLLQQVDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 58
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: D8LG80_ECTSI (40S ribosomal protein S30 n=2 Tax=PX clade TaxID=569578 RepID=D8LG80_ECTSI) HSP 1 Score: 83.2 bits (204), Expect = 7.520e-20 Identity = 41/45 (91.11%), Postives = 43/45 (95.56%), Query Frame = 1 Query: 40 VDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 174 +DK EKKK PRGRAKKRMQYNRRFVNVVTGVGGK+LGPNSNAAKV Sbjct: 21 IDKIEKKKQPRGRAKKRMQYNRRFVNVVTGVGGKRLGPNSNAAKV 65
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: K0R2S3_THAOC (Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0R2S3_THAOC) HSP 1 Score: 77.0 bits (188), Expect = 9.400e-17 Identity = 37/45 (82.22%), Postives = 42/45 (93.33%), Query Frame = 1 Query: 40 VDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 174 V+ QEKKK PRGRAKKRMQYNRR+VNVVTG+GGKK+GPNSNA K+ Sbjct: 78 VEAQEKKKQPRGRAKKRMQYNRRYVNVVTGMGGKKVGPNSNADKM 122
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: A0A7S2V4V4_9STRA (Hypothetical protein n=3 Tax=Ochrophyta TaxID=2696291 RepID=A0A7S2V4V4_9STRA) HSP 1 Score: 76.3 bits (186), Expect = 2.870e-16 Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = 1 Query: 40 VDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 174 V+ QEKKK GRAKKRMQYNRRFVNVVTGVGGKKLGPNSNA+KV Sbjct: 96 VEAQEKKKKLTGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNASKV 140
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: A0A1E7F7Q1_9STRA (40S ribosomal protein S30 n=4 Tax=Bacillariophyta TaxID=2836 RepID=A0A1E7F7Q1_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 6.010e-15 Identity = 35/46 (76.09%), Postives = 43/46 (93.48%), Query Frame = 1 Query: 40 VDKQEK-KKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 174 V+KQE+ KK PRGRAKKR+QYNRR+VNVVTG+GGK++GPNSNA K+ Sbjct: 21 VEKQEEGKKQPRGRAKKRLQYNRRYVNVVTGMGGKRVGPNSNADKM 66
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: A0A4D9D2L7_9STRA (Ubiquitin-like domain-containing protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9D2L7_9STRA) HSP 1 Score: 71.2 bits (173), Expect = 2.740e-14 Identity = 34/45 (75.56%), Postives = 41/45 (91.11%), Query Frame = 1 Query: 40 VDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 174 V+KQEK+K PRGRAKKR+ Y+RRF+NV TGVGGK+LGPNSNA K+ Sbjct: 96 VEKQEKRKTPRGRAKKRVLYSRRFLNVATGVGGKRLGPNSNADKM 140
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: A0A8J2X0V5_9STRA (Hypothetical protein n=3 Tax=Pelagomonadales TaxID=54409 RepID=A0A8J2X0V5_9STRA) HSP 1 Score: 70.1 bits (170), Expect = 1.940e-13 Identity = 35/42 (83.33%), Postives = 37/42 (88.10%), Query Frame = 1 Query: 40 VDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNA 165 V+KQEKKK P GRAKKRM YNRRFVNVV GVGGK+ GPNSNA Sbjct: 110 VEKQEKKKLPTGRAKKRMLYNRRFVNVVAGVGGKRFGPNSNA 151
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: A0A2P6VFJ9_9CHLO (40S ribosomal protein S30 n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6VFJ9_9CHLO) HSP 1 Score: 66.2 bits (160), Expect = 3.500e-13 Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 1 Query: 40 VDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNS 159 V KQEKKK P+GRA+KR+QYNRRFVNVV G GGKK GPNS Sbjct: 21 VPKQEKKKTPKGRARKRLQYNRRFVNVVVGFGGKKKGPNS 60
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: A0A2R5GNZ5_9STRA (Ubiquitin n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GNZ5_9STRA) HSP 1 Score: 67.8 bits (164), Expect = 7.840e-13 Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 1 Query: 40 VDKQ-EKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 174 V+KQ +KKKDPRGRAKKR+QYNRRFVNVV GGK LGPN+NA ++ Sbjct: 96 VEKQGDKKKDPRGRAKKRLQYNRRFVNVVRAPGGKTLGPNNNAERI 141
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Match: A0A484DSZ2_BRELC (Uncharacterized protein n=1 Tax=Bremia lactucae TaxID=4779 RepID=A0A484DSZ2_BRELC) HSP 1 Score: 65.1 bits (157), Expect = 1.820e-12 Identity = 37/46 (80.43%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 40 VDKQE-KKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGPNSNAAKV 174 V KQE KK GRAKKR QYNRRFVNVV G GGKKLGPNSNAAKV Sbjct: 40 VPKQEDSKKALTGRAKKRWQYNRRFVNVVAGSGGKKLGPNSNAAKV 85 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|157473 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_495 ID=mRNA_495|Name=jgi.p|Trimin1|157473|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=177bp|location=Sequence derived from alignment at Contig_3:1882390..1882566+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGCTGATCTCACTGAATCTTTCTTATCTGCTGCAACAGGTCGACAAGCAback to top protein sequence of jgi.p|Trimin1|157473 >Trimin1|157473|e_gw1.3.337.1 ID=Trimin1|157473|e_gw1.3.337.1|Name=jgi.p|Trimin1|157473|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=59bp MLISLNLSYLLQQVDKQEKKKDPRGRAKKRMQYNRRFVNVVTGVGGKKLGback to top mRNA from alignment at Contig_3:1882390..1882566+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_495 ID=mRNA_495|Name=jgi.p|Trimin1|157473|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=177bp|location=Sequence derived from alignment at Contig_3:1882390..1882566+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_3:1882390..1882566+ >mRNA_495 ID=mRNA_495|Name=jgi.p|Trimin1|157473|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=177bp|location=Sequence derived from alignment at Contig_3:1882390..1882566+ (Tribonema minus UTEX_B_3156 )back to top |