mRNA_2369 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|158184 vs. uniprot
Match: A0A835YZ39_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YZ39_9STRA) HSP 1 Score: 72.8 bits (177), Expect = 4.090e-13 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 1 Query: 1 MKAHVKGVHLKIKTVICTEDGCTRKFTSKQHMQ 99 MKAHVKGVHLKIKTVICTEDGCTRKFTSKQHMQ Sbjct: 1 MKAHVKGVHLKIKTVICTEDGCTRKFTSKQHMQ 33 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|158184 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_2369 ID=mRNA_2369|Name=jgi.p|Trimin1|158184|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=492bp|location=Sequence derived from alignment at Contig_5:1027438..1027929+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGAAGGCTCACGTCAAAGGCGTCCACCTGAAAATCAAGACTGTGATCTGback to top protein sequence of jgi.p|Trimin1|158184 >Trimin1|158184|e_gw1.5.187.1 ID=Trimin1|158184|e_gw1.5.187.1|Name=jgi.p|Trimin1|158184|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=164bp MKAHVKGVHLKIKTVICTEDGCTRKFTSKQHMQSHVSAVHHGVKNIVCTEback to top mRNA from alignment at Contig_5:1027438..1027929+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_2369 ID=mRNA_2369|Name=jgi.p|Trimin1|158184|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=492bp|location=Sequence derived from alignment at Contig_5:1027438..1027929+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_5:1027438..1027929+ >mRNA_2369 ID=mRNA_2369|Name=jgi.p|Trimin1|158184|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=492bp|location=Sequence derived from alignment at Contig_5:1027438..1027929+ (Tribonema minus UTEX_B_3156 )back to top |