mRNA_1930 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|163441 vs. uniprot
Match: A0A836CHP6_9STRA (Zinc finger protein 271-like protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CHP6_9STRA) HSP 1 Score: 89.0 bits (219), Expect = 1.170e-18 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 1 Query: 1 MLFPTSGHLVTHKRQHTSEKPFKCDFESCDYKCKTSSSL 117 MLFPTSGHLVTHKRQHTSEKPFKCDFESCDYKCKTSSSL Sbjct: 1 MLFPTSGHLVTHKRQHTSEKPFKCDFESCDYKCKTSSSL 39
BLAST of jgi.p|Trimin1|163441 vs. uniprot
Match: T1G709_HELRO (Uncharacterized protein n=1 Tax=Helobdella robusta TaxID=6412 RepID=T1G709_HELRO) HSP 1 Score: 49.3 bits (116), Expect = 9.060e-5 Identity = 19/30 (63.33%), Postives = 22/30 (73.33%), Query Frame = 1 Query: 7 FPTSGHLVTHKRQHTSEKPFKCDFESCDYK 96 + S HL HKR HT EKPFKC FE+CD+K Sbjct: 6 YTKSSHLKAHKRLHTGEKPFKCQFENCDWK 35 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|163441 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_1930 ID=mRNA_1930|Name=jgi.p|Trimin1|163441|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=582bp|location=Sequence derived from alignment at Contig_26:539391..539972- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGCTCTTTCCTACATCCGGTCATCTCGTCACACACAAGCGCCAACATACback to top protein sequence of jgi.p|Trimin1|163441 >Trimin1|163441|e_gw1.26.101.1 ID=Trimin1|163441|e_gw1.26.101.1|Name=jgi.p|Trimin1|163441|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=194bp MLFPTSGHLVTHKRQHTSEKPFKCDFESCDYKCKTSSSLNRHTLTHSGAKback to top mRNA from alignment at Contig_26:539391..539972- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_1930 ID=mRNA_1930|Name=jgi.p|Trimin1|163441|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=582bp|location=Sequence derived from alignment at Contig_26:539391..539972- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_26:539391..539972- >mRNA_1930 ID=mRNA_1930|Name=jgi.p|Trimin1|163441|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=582bp|location=Sequence derived from alignment at Contig_26:539391..539972- (Tribonema minus UTEX_B_3156 )back to top |