mRNA_17667 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: A0A836CH91_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CH91_9STRA) HSP 1 Score: 117 bits (294), Expect = 6.400e-34 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1 Query: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK 150 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK Sbjct: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK 50
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: A0A7S0W7F5_9CRYP (Hypothetical protein (Fragment) n=1 Tax=Hemiselmis tepida TaxID=464990 RepID=A0A7S0W7F5_9CRYP) HSP 1 Score: 96.7 bits (239), Expect = 2.910e-24 Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = 1 Query: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK 150 MP GVKK +LP K+C CNRPF WRKKWE CWDEVTTCSKSCN+ RRK K Sbjct: 97 MPNGVKKENLPTKVCVTCNRPFTWRKKWEKCWDEVTTCSKSCNAQRRKAK 146
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: A0A1Z5K3C1_FISSO (Uncharacterized protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5K3C1_FISSO) HSP 1 Score: 96.3 bits (238), Expect = 1.980e-23 Identity = 39/47 (82.98%), Postives = 41/47 (87.23%), Query Frame = 1 Query: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARR 141 MPRGVKK LP KIC +C+RPFNWRKKWESCWDEVTTCSKSCN RR Sbjct: 1 MPRGVKKEHLPSKICVMCHRPFNWRKKWESCWDEVTTCSKSCNRQRR 47
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: A0A7S0GXJ7_MICPS (Hypothetical protein (Fragment) n=1 Tax=Micromonas pusilla TaxID=38833 RepID=A0A7S0GXJ7_MICPS) HSP 1 Score: 93.2 bits (230), Expect = 5.500e-22 Identity = 36/48 (75.00%), Postives = 42/48 (87.50%), Query Frame = 1 Query: 7 RGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK 150 RGVKK +LP K+C +C+RPF WRKKWE CWDEVTTCSKSCN+ARR+ K Sbjct: 66 RGVKKENLPTKVCVVCDRPFTWRKKWERCWDEVTTCSKSCNAARRREK 113
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: K8EHJ5_9CHLO (Uncharacterized protein n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8EHJ5_9CHLO) HSP 1 Score: 90.5 bits (223), Expect = 7.650e-22 Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK 150 MP VKK +LP K+C +CNRPF WRKKWE CWDEVTTCSKSCN R++ K Sbjct: 1 MPANVKKENLPEKVCVVCNRPFTWRKKWERCWDEVTTCSKSCNVKRKREK 50
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: B8BYZ3_THAPS (Uncharacterized protein n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8BYZ3_THAPS) HSP 1 Score: 91.7 bits (226), Expect = 1.440e-21 Identity = 34/48 (70.83%), Postives = 41/48 (85.42%), Query Frame = 1 Query: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRK 144 MPRG+KK +LP K+C +C+RPF WRKKWE CWDEVTTCSKSCN R++ Sbjct: 1 MPRGIKKENLPSKLCVVCDRPFTWRKKWERCWDEVTTCSKSCNRKRKE 48
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: A0A7S2T0B9_9CHLO (Hypothetical protein (Fragment) n=1 Tax=Chloropicon primus TaxID=1764295 RepID=A0A7S2T0B9_9CHLO) HSP 1 Score: 87.0 bits (214), Expect = 4.380e-21 Identity = 32/50 (64.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK 150 MPRGVKK +LP K+C +CNRPF WRKKWE CW+EV TCS+ C + R++ K Sbjct: 52 MPRGVKKENLPTKVCVVCNRPFTWRKKWERCWEEVQTCSERCKNERKRSK 101
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: A4S0N5_OSTLU (Uncharacterized protein n=1 Tax=Ostreococcus lucimarinus (strain CCE9901) TaxID=436017 RepID=A4S0N5_OSTLU) HSP 1 Score: 88.6 bits (218), Expect = 5.300e-21 Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 1 Query: 7 RGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARR 141 RGVKK +LP K+C +C+RPF WRKKWE+CWDEVTTCSKSCN R+ Sbjct: 2 RGVKKENLPSKVCVVCDRPFTWRKKWENCWDEVTTCSKSCNGKRK 46
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: UPI0016891602 (DUF2256 domain-containing protein n=1 Tax=Microcoleus sp. FACHB-1515 TaxID=2692821 RepID=UPI0016891602) HSP 1 Score: 85.1 bits (209), Expect = 6.570e-21 Identity = 34/50 (68.00%), Postives = 37/50 (74.00%), Query Frame = 1 Query: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK 150 MPRGVKKSDLP KIC +C RPF WRKKWE+CWDEV CS C R + K Sbjct: 1 MPRGVKKSDLPTKICPVCQRPFTWRKKWENCWDEVKYCSDRCRRHRTEAK 50
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Match: A0A6P0QLC2_9CYAN (DUF2256 domain-containing protein n=1 Tax=Microcoleus sp. SIO2G3 TaxID=2607795 RepID=A0A6P0QLC2_9CYAN) HSP 1 Score: 84.3 bits (207), Expect = 1.360e-20 Identity = 34/50 (68.00%), Postives = 37/50 (74.00%), Query Frame = 1 Query: 1 MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVK 150 MPRGVKKSDLP KIC +C+RPF WRKKWE+CWDEV CS C R K Sbjct: 1 MPRGVKKSDLPTKICPVCHRPFTWRKKWENCWDEVKYCSDRCRRHRLAAK 50 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|138859 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_17667 ID=mRNA_17667|Name=jgi.p|Trimin1|138859|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=150bp|location=Sequence derived from alignment at Contig_225:35844..36088+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGCCGCGAGGGGTGAAGAAGTCCGACCTCCCCTTCAAGATCTGCACCATback to top protein sequence of jgi.p|Trimin1|138859 >Trimin1|138859|gw1.225.1.1 ID=Trimin1|138859|gw1.225.1.1|Name=jgi.p|Trimin1|138859|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=50bp MPRGVKKSDLPFKICTICNRPFNWRKKWESCWDEVTTCSKSCNSARRKVKback to top mRNA from alignment at Contig_225:35844..36088+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_17667 ID=mRNA_17667|Name=jgi.p|Trimin1|138859|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=245bp|location=Sequence derived from alignment at Contig_225:35844..36088+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_225:35844..36088+ >mRNA_17667 ID=mRNA_17667|Name=jgi.p|Trimin1|138859|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=150bp|location=Sequence derived from alignment at Contig_225:35844..36088+ (Tribonema minus UTEX_B_3156 )back to top |