mRNA_11808 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A0A835ZDJ9_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZDJ9_9STRA) HSP 1 Score: 114 bits (284), Expect = 2.470e-32 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 1 Query: 1 MGDLHRQIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQCYCLTEEQ 156 MGDLHRQIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQCYCLTEEQ Sbjct: 1 MGDLHRQIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQCYCLTEEQ 52
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A0A3P3YIV0_PLABS (Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A3P3YIV0_PLABS) HSP 1 Score: 57.8 bits (138), Expect = 1.590e-8 Identity = 22/46 (47.83%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 19 QIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQCYCLTEEQ 156 ++ E++ +GW +LSQHCP+C+TVL+ + + CVSC+ C+TEEQ Sbjct: 14 RLSEKMMQGWTLLSQHCPRCTTVLVGHKTHGVECVSCEMPCVTEEQ 59
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A0A0G4IL30_PLABS (Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4IL30_PLABS) HSP 1 Score: 57.8 bits (138), Expect = 2.130e-8 Identity = 22/46 (47.83%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 19 QIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQCYCLTEEQ 156 ++ E++ +GW +LSQHCP+C+TVL+ + + CVSC+ C+TEEQ Sbjct: 586 RLSEKMMQGWTLLSQHCPRCTTVLVGHKTHGVECVSCEMPCVTEEQ 631
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A0A1D2A727_AUXPR (Uncharacterized protein n=2 Tax=Auxenochlorella protothecoides TaxID=3075 RepID=A0A1D2A727_AUXPR) HSP 1 Score: 56.6 bits (135), Expect = 4.350e-8 Identity = 21/42 (50.00%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 7 DLHRQIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQ 132 ++ + + +R+ GW +L Q CP CSTVL+RSR++Q+FCVSC+ Sbjct: 107 EISQSLADRMLHGWTLLGQSCPICSTVLVRSRERQVFCVSCK 148
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A0A1D1ZSX5_AUXPR (Uncharacterized protein (Fragment) n=1 Tax=Auxenochlorella protothecoides TaxID=3075 RepID=A0A1D1ZSX5_AUXPR) HSP 1 Score: 56.6 bits (135), Expect = 4.450e-8 Identity = 21/42 (50.00%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 7 DLHRQIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQ 132 ++ + + +R+ GW +L Q CP CSTVL+RSR++Q+FCVSC+ Sbjct: 112 EISQSLADRMLHGWTLLGQSCPICSTVLVRSRERQVFCVSCK 153
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A9NSW4_PICSI (Uncharacterized protein n=1 Tax=Picea sitchensis TaxID=3332 RepID=A9NSW4_PICSI) HSP 1 Score: 56.2 bits (134), Expect = 4.680e-8 Identity = 23/48 (47.92%), Postives = 35/48 (72.92%), Query Frame = 1 Query: 7 DLHRQIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQCYCLTE 150 D I +L +GWA+LS HCPQC T L+R+R+++++CVSC + +TE Sbjct: 26 DSSAAIAVKLLQGWALLSDHCPQCVTPLVRNRERRMYCVSCSQWVITE 73
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A0A8K1C5E5_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1C5E5_PYTOL) HSP 1 Score: 55.5 bits (132), Expect = 6.740e-8 Identity = 24/52 (46.15%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 7 DLHRQIGERLSEGWAMLSQHCP--QCSTVLLRSRDQQIFCVSCQCYCLTEEQ 156 D ++GE+L +GW ML HCP +C T L+R++ Q+FCVSC + +TEE+ Sbjct: 15 DASARLGEKLLQGWTMLGVHCPSDECFTPLVRNKQGQMFCVSCNRFAITEEE 66
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: UPI001AE72D59 (protein ZNRD2 isoform X2 n=2 Tax=Gallus gallus TaxID=9031 RepID=UPI001AE72D59) HSP 1 Score: 50.8 bits (120), Expect = 4.150e-6 Identity = 20/41 (48.78%), Postives = 29/41 (70.73%), Query Frame = 1 Query: 10 LHRQIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQ 132 + R +G+ L G+ ML CPQC T+LL+ R QQ++CV+CQ Sbjct: 27 ISRALGQYLLRGYRMLGSCCPQCQTILLQDRQQQLYCVTCQ 67
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A0A7S0D1M1_9EUKA (Hypothetical protein n=1 Tax=Amorphochlora amoebiformis TaxID=1561963 RepID=A0A7S0D1M1_9EUKA) HSP 1 Score: 50.1 bits (118), Expect = 1.090e-5 Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1 Query: 7 DLHRQIGERLSEGWAMLSQHCPQ--CSTVLLRSRDQQIFCVSCQ 132 ++ +IG +L GWAML+++CP+ C VLLRSRD + +CVSC+ Sbjct: 151 EISDKIGAKLLAGWAMLNEYCPKQTCKCVLLRSRDGEKYCVSCE 194
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Match: A0A8J9WKZ4_9CHLO (Uncharacterized protein n=1 Tax=Coccomyxa sp. Obi TaxID=2315456 RepID=A0A8J9WKZ4_9CHLO) HSP 1 Score: 47.0 bits (110), Expect = 5.310e-5 Identity = 18/38 (47.37%), Postives = 29/38 (76.32%), Query Frame = 1 Query: 40 EGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQCYCLTEE 153 +GW +L CP+C T+L+R+R++++FCVSC + L EE Sbjct: 3 QGWTLLGDQCPRCLTILVRNRERELFCVSCDMF-LREE 39 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|173432 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 11
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_11808 ID=mRNA_11808|Name=jgi.p|Trimin1|173432|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=156bp|location=Sequence derived from alignment at Contig_102:162662..162817- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGGGCGATCTACATAGGCAAATCGGCGAGCGACTCTCCGAGGGCTGGGCback to top protein sequence of jgi.p|Trimin1|173432 >Trimin1|173432|e_gw1.102.109.1 ID=Trimin1|173432|e_gw1.102.109.1|Name=jgi.p|Trimin1|173432|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=52bp MGDLHRQIGERLSEGWAMLSQHCPQCSTVLLRSRDQQIFCVSCQCYCLTEback to top mRNA from alignment at Contig_102:162662..162817- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_11808 ID=mRNA_11808|Name=jgi.p|Trimin1|173432|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=156bp|location=Sequence derived from alignment at Contig_102:162662..162817- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_102:162662..162817- >mRNA_11808 ID=mRNA_11808|Name=jgi.p|Trimin1|173432|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=156bp|location=Sequence derived from alignment at Contig_102:162662..162817- (Tribonema minus UTEX_B_3156 )back to top |