mRNA_11019 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|351344 vs. uniprot
Match: A0A835YII5_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YII5_9STRA) HSP 1 Score: 103 bits (257), Expect = 7.760e-26 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 208 AEEGHWHGGHRYLKGIRVLPDAPPDADYGSTNALLRQLYLQRHQAQ 345 AEEGHWHGGHRYLKGIRVLPDAPPDADYGSTNALLRQLYLQRHQAQ Sbjct: 70 AEEGHWHGGHRYLKGIRVLPDAPPDADYGSTNALLRQLYLQRHQAQ 115 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|351344 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_11019 ID=mRNA_11019|Name=jgi.p|Trimin1|351344|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=417bp|location=Sequence derived from alignment at Contig_88:85841..87430- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGGAGATGCAGCACCGGTTGCTATTCCAGCAGCAGCAGCAGCAGCAGTTback to top protein sequence of jgi.p|Trimin1|351344 >Trimin1|351344|estExt_Genemark1.C_Ctg_880012 ID=Trimin1|351344|estExt_Genemark1.C_Ctg_880012|Name=jgi.p|Trimin1|351344|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=128bp MEMQHRLLFQQQQQQQLLEEQDRSDRNASASSDGSYGHHQHHWRQPAATTback to top mRNA from alignment at Contig_88:85841..87430- Legend: polypeptideexonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_11019 ID=mRNA_11019|Name=jgi.p|Trimin1|351344|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=1590bp|location=Sequence derived from alignment at Contig_88:85841..87430- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_88:85841..87430- >mRNA_11019 ID=mRNA_11019|Name=jgi.p|Trimin1|351344|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=384bp|location=Sequence derived from alignment at Contig_88:85841..87430- (Tribonema minus UTEX_B_3156 )back to top |