|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Sphaerotrichia firma female
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR002151 | Kinesin light chain | PRINTS | PR00381 | KINESINLIGHT | coord: 142..159
score: 37.78
coord: 221..242
score: 37.73
coord: 77..95
score: 41.05
coord: 186..206
score: 28.1 |
| IPR019734 | Tetratricopeptide repeat | SMART | SM00028 | tpr_5 | coord: 272..305
e-value: 0.064
score: 22.4
coord: 455..488
e-value: 0.15
score: 21.2
coord: 62..95
e-value: 2.6
score: 17.0
coord: 497..530
e-value: 42.0
score: 9.4
coord: 146..179
e-value: 2.3E-4
score: 30.5
coord: 539..572
e-value: 2.3
score: 17.2
coord: 104..137
e-value: 12.0
score: 14.2
coord: 314..347
e-value: 21.0
score: 12.1
coord: 20..53
e-value: 0.0075
score: 25.5
coord: 356..389
e-value: 19.0
score: 12.4
coord: 230..263
e-value: 5.7
score: 15.9
coord: 188..221
e-value: 130.0
score: 5.2
coord: 396..429
e-value: 73.0
score: 7.4 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 146..179
score: 10.148 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 272..305
score: 8.113 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 356..389
score: 6.874 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 62..95
score: 6.372 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 455..488
score: 8.408 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 314..347
score: 8.201 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 20..53
score: 10.207 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 188..221
score: 5.782 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 539..572
score: 6.49 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 104..137
score: 6.992 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 230..263
score: 7.021 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 497..530
score: 6.815 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 396..429
score: 6.431 |
| None | No IPR available | PFAM | PF13374 | TPR_10 | coord: 187..227
e-value: 9.6E-7
score: 28.5 |
| None | No IPR available | PFAM | PF13424 | TPR_12 | coord: 498..566
e-value: 5.2E-13
score: 49.1
coord: 105..178
e-value: 2.0E-17
score: 63.3
coord: 19..94
e-value: 1.4E-13
score: 50.9
coord: 228..304
e-value: 1.4E-17
score: 63.8
coord: 423..487
e-value: 2.4E-9
score: 37.3
coord: 315..388
e-value: 1.3E-16
score: 60.6 |
| None | No IPR available | PANTHER | PTHR45641 | FAMILY NOT NAMED | coord: 8..279 |
| None | No IPR available | PANTHER | PTHR45641 | FAMILY NOT NAMED | coord: 87..423 |
| None | No IPR available | PANTHER | PTHR45641 | FAMILY NOT NAMED | coord: 285..508 |
| None | No IPR available | PANTHER | PTHR45641:SF1 | | coord: 285..508 |
| None | No IPR available | PANTHER | PTHR45641 | FAMILY NOT NAMED | coord: 425..588 |
| None | No IPR available | PANTHER | PTHR45641:SF1 | | coord: 8..279 |
| None | No IPR available | PANTHER | PTHR45641:SF1 | | coord: 87..423 |
| None | No IPR available | PANTHER | PTHR45641:SF1 | | coord: 425..588 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 595..613 |
| None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 614..617 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..594 |
| None | No IPR available | TMHMM | TMhelix | | coord: 593..615 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 333..425
e-value: 6.3E-15
score: 57.2 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 6..173
e-value: 1.5E-50
score: 173.8
coord: 174..332
e-value: 1.4E-51
score: 177.2 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 426..592
e-value: 2.0E-43
score: 150.5 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 17..261 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 143..568 |
| IPR013026 | Tetratricopeptide repeat-containing domain | PROSITE | PS50293 | TPR_REGION | coord: 20..572
score: 32.706 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_S-firma_F_contig1085.1139.1 ID=prot_S-firma_F_contig1085.1139.1|Name=mRNA_S-firma_F_contig1085.1139.1|organism=Sphaerotrichia firma ET2_F female|type=polypeptide|length=618bp
MTRGGRNKEKSMGADHPELANTFCNLGADAAEANKFEEAVRYYRRALAIQ
EKALGVDHPEVGNILASVGTCAGKLGKTEEADRHCRRALEIRKKTLGVGH
PNLRNILLHLGNYNHQMGRFEEAEQYSRRGLAILEKTLGVDHPQAAKALF
NLGVYARTAGKTEEAERYYRRALAIQEKKLGVDHPELARTLDTLGVCASE
AGRMEEAERYGRRAVASHTKALGADHPQVAMTLHNLGVSAGRAGRAEEAA
GYHRRALAIQEKTLGVDHPHVATSLCSLGAGAGEAGRPEEAERYYRRALK
IREKKLGSEHPDVVNVMLLLGNYNNEMGRTEEAVRYRRRALAIQERTLGA
DDPAVAGNLHNLGIYAREAGKTGEAEAYLRRALAIREKTQGGLEVTRCLV
QLGVTLREAGRADEAEGYFRRARETGKTGEAEGYIRRALAIMREKALGAG
DPDLARFLFQLGVTASEAGRGEEAKGYFQRALAIQEELVGADNPSLIAVL
SALGAGVYAAGRPEEAEGYYRRALTIQMQALGFDHPDVATTLSKLGCCAR
KLGLKEDAERLFRQALVITEGKLGPDHPRTVETRAELAELGKPSWNVMIA
TVAVGLASFYFGWSWRS* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|