mRNA_S-firma_F_contig10053.117.1 (mRNA) Sphaerotrichia firma ET2_F female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_S-firma_F_contig10053.117.1 vs. uniprot
Match: A0A6H5LFU5_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LFU5_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 3.290e-5 Identity = 20/24 (83.33%), Postives = 23/24 (95.83%), Query Frame = -1 Query: 7 QMLHLWLHLKSDNWARWREVQDQR 78 +MLHLWLHLKSDNW RWRE+QD+R Sbjct: 1056 EMLHLWLHLKSDNWVRWREMQDRR 1079
BLAST of mRNA_S-firma_F_contig10053.117.1 vs. uniprot
Match: D8LHA8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHA8_ECTSI) HSP 1 Score: 52.8 bits (125), Expect = 4.410e-5 Identity = 20/24 (83.33%), Postives = 22/24 (91.67%), Query Frame = -1 Query: 7 QMLHLWLHLKSDNWARWREVQDQR 78 +MLHLWLHLKSDNW RWRE QD+R Sbjct: 1032 EMLHLWLHLKSDNWVRWRETQDRR 1055 The following BLAST results are available for this feature:
BLAST of mRNA_S-firma_F_contig10053.117.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Sphaerotrichia firma female vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_S-firma_F_contig10053.117.1 >prot_S-firma_F_contig10053.117.1 ID=prot_S-firma_F_contig10053.117.1|Name=mRNA_S-firma_F_contig10053.117.1|organism=Sphaerotrichia firma ET2_F female|type=polypeptide|length=111bp YIPLVLDLAPPGPVVALQVQPQVEHLLFFRVVQVEQRWVRPVAHVRSVAVback to top mRNA from alignment at S-firma_F_contig10053:2354..2809+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_S-firma_F_contig10053.117.1 ID=mRNA_S-firma_F_contig10053.117.1|Name=mRNA_S-firma_F_contig10053.117.1|organism=Sphaerotrichia firma ET2_F female|type=mRNA|length=456bp|location=Sequence derived from alignment at S-firma_F_contig10053:2354..2809+ (Sphaerotrichia firma ET2_F female)back to top Coding sequence (CDS) from alignment at S-firma_F_contig10053:2354..2809+ >mRNA_S-firma_F_contig10053.117.1 ID=mRNA_S-firma_F_contig10053.117.1|Name=mRNA_S-firma_F_contig10053.117.1|organism=Sphaerotrichia firma ET2_F female|type=CDS|length=666bp|location=Sequence derived from alignment at S-firma_F_contig10053:2354..2809+ (Sphaerotrichia firma ET2_F female)back to top |