mRNA_S-firma_F_contig10005.68.1 (mRNA) Sphaerotrichia firma ET2_F female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_S-firma_F_contig10005.68.1 vs. uniprot
Match: D7FWJ7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FWJ7_ECTSI) HSP 1 Score: 92.4 bits (228), Expect = 1.960e-23 Identity = 40/61 (65.57%), Postives = 52/61 (85.25%), Query Frame = 1 Query: 1 MADDEISYQSATRDVLLSAAKVIGSECVDVNLAFTKCKAQNSDPEACLKLGSAVLECNNRV 183 M ++++ + SATRDVL+S AK++GS CVD NLAFTKCKA+NSDPEAC+KLG AVLEC ++ Sbjct: 1 MGEEDMPFPSATRDVLISTAKLLGSSCVDENLAFTKCKAENSDPEACMKLGVAVLECTSKA 61
BLAST of mRNA_S-firma_F_contig10005.68.1 vs. uniprot
Match: K3WSU2_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WSU2_GLOUD) HSP 1 Score: 55.1 bits (131), Expect = 3.300e-8 Identity = 27/58 (46.55%), Postives = 36/58 (62.07%), Query Frame = 1 Query: 1 MADDEISYQSATRDVLLS-AAKVIGSECVDVNLAFTKCKAQNSDPEACLKLGSAVLEC 171 MAD + +T + L+ AA+V+G EC D NLAF +CK +N+DP ACL G V C Sbjct: 1 MADAATNTLPSTDNTSLTCAARVLGFECADANLAFLRCKQENADPRACLAQGEKVTAC 58
BLAST of mRNA_S-firma_F_contig10005.68.1 vs. uniprot
Match: A0A5D6YII0_9STRA (Uncharacterized protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6YII0_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 8.400e-6 Identity = 22/42 (52.38%), Postives = 27/42 (64.29%), Query Frame = 1 Query: 46 LLSAAKVIGSECVDVNLAFTKCKAQNSDPEACLKLGSAVLEC 171 L AA+V+G EC D NLAF +CK ++DP ACL G V C Sbjct: 102 LTCAARVLGYECADPNLAFLRCKQADADPRACLAQGEKVTAC 143
BLAST of mRNA_S-firma_F_contig10005.68.1 vs. uniprot
Match: A0A6L2NXU0_TANCI (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B-like n=1 Tax=Tanacetum cinerariifolium TaxID=118510 RepID=A0A6L2NXU0_TANCI) HSP 1 Score: 47.4 bits (111), Expect = 2.860e-5 Identity = 22/46 (47.83%), Postives = 29/46 (63.04%), Query Frame = 1 Query: 34 TRDVLLSAAKVIGSECVDVNLAFTKCKAQNSDPEACLKLGSAVLEC 171 T VL+SA+K I + C N+AF KCK +S+PE CL+ G V C Sbjct: 11 TSAVLMSASKHIATRCRGENVAFLKCKKDDSNPEKCLEKGRQVTRC 56
BLAST of mRNA_S-firma_F_contig10005.68.1 vs. uniprot
Match: S8DNJ9_FOMPI (NADH-ubiquinone oxidoreductase n=5 Tax=Fomitopsidaceae TaxID=1769247 RepID=S8DNJ9_FOMPI) HSP 1 Score: 47.4 bits (111), Expect = 6.840e-5 Identity = 24/53 (45.28%), Postives = 29/53 (54.72%), Query Frame = 1 Query: 13 EISYQSATRDVLLSAAKVIGSECVDVNLAFTKCKAQNSDPEACLKLGSAVLEC 171 ++ AT L SAA +G+ C D N F CKA+N DPE CLK G V C Sbjct: 27 KVQELGATSAPLKSAAFFLGAYCKDYNEDFMLCKAENRDPEHCLKEGRRVTRC 79 The following BLAST results are available for this feature:
BLAST of mRNA_S-firma_F_contig10005.68.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Sphaerotrichia firma female vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_S-firma_F_contig10005.68.1 >prot_S-firma_F_contig10005.68.1 ID=prot_S-firma_F_contig10005.68.1|Name=mRNA_S-firma_F_contig10005.68.1|organism=Sphaerotrichia firma ET2_F female|type=polypeptide|length=62bp MADDEISYQSATRDVLLSAAKVIGSECVDVNLAFTKCKAQNSDPEACLKLback to top mRNA from alignment at S-firma_F_contig10005:3696..4218- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_S-firma_F_contig10005.68.1 ID=mRNA_S-firma_F_contig10005.68.1|Name=mRNA_S-firma_F_contig10005.68.1|organism=Sphaerotrichia firma ET2_F female|type=mRNA|length=523bp|location=Sequence derived from alignment at S-firma_F_contig10005:3696..4218- (Sphaerotrichia firma ET2_F female)back to top Coding sequence (CDS) from alignment at S-firma_F_contig10005:3696..4218- >mRNA_S-firma_F_contig10005.68.1 ID=mRNA_S-firma_F_contig10005.68.1|Name=mRNA_S-firma_F_contig10005.68.1|organism=Sphaerotrichia firma ET2_F female|type=CDS|length=372bp|location=Sequence derived from alignment at S-firma_F_contig10005:3696..4218- (Sphaerotrichia firma ET2_F female)back to top |