|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR002885 | Pentatricopeptide repeat | PFAM | PF01535 | PPR | coord: 134..163
e-value: 0.0018
score: 18.4 |
| IPR002885 | Pentatricopeptide repeat | TIGRFAM | TIGR00756 | TIGR00756 | coord: 133..167
e-value: 1.8E-5
score: 22.6
coord: 483..509
e-value: 3.4E-4
score: 18.6
coord: 518..549
e-value: 8.5E-7
score: 26.8
coord: 168..202
e-value: 8.3E-8
score: 29.9
coord: 308..342
e-value: 6.6E-6
score: 24.0
coord: 448..482
e-value: 4.0E-7
score: 27.8
coord: 343..377
e-value: 0.0011
score: 16.9
coord: 378..411
e-value: 8.5E-8
score: 29.9
coord: 203..235
e-value: 1.3E-4
score: 19.9
coord: 274..306
e-value: 2.3E-6
score: 25.4
coord: 553..585
e-value: 5.1E-8
score: 30.6
coord: 588..620
e-value: 2.5E-5
score: 22.2
coord: 238..272
e-value: 5.6E-6
score: 24.2
coord: 413..446
e-value: 1.1E-5
score: 23.3 |
| IPR002885 | Pentatricopeptide repeat | PFAM | PF13812 | PPR_3 | coord: 538..597
e-value: 1.5E-11
score: 44.2
coord: 294..354
e-value: 9.7E-12
score: 44.8
coord: 433..494
e-value: 1.2E-11
score: 44.5 |
| IPR002885 | Pentatricopeptide repeat | PFAM | PF13041 | PPR_2 | coord: 375..422
e-value: 1.5E-9
score: 37.9
coord: 236..283
e-value: 3.7E-7
score: 30.2
coord: 165..212
e-value: 2.6E-12
score: 46.7 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 551..585
score: 12.847 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 62..96
score: 6.818 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 166..200
score: 12.266 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 97..127
score: 7.004 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 341..375
score: 10.073 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 201..235
score: 10.49 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 516..550
score: 10.852 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 376..410
score: 12.573 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 586..620
score: 11.433 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 271..305
score: 12.025 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 306..340
score: 11.126 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 131..165
score: 10.709 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 481..515
score: 10.622 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 236..270
score: 10.994 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 411..445
score: 11.005 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 446..480
score: 11.696 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 20..129
e-value: 1.4E-6
score: 29.9 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 317..421
e-value: 1.3E-31
score: 111.3
coord: 130..210
e-value: 9.2E-25
score: 89.0
coord: 211..316
e-value: 1.6E-31
score: 111.1
coord: 527..620
e-value: 1.8E-28
score: 101.1
coord: 422..526
e-value: 1.1E-32
score: 114.9 |
| None | No IPR available | PANTHER | PTHR47447 | FAMILY NOT NAMED | coord: 66..305
coord: 373..575
coord: 305..514
coord: 198..399
coord: 447..619 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_S-dermatodea_contig10148.110.1 ID=prot_S-dermatodea_contig10148.110.1|Name=mRNA_S-dermatodea_contig10148.110.1|organism=Saccorhiza dermatodea SderLu1190fm monoicous|type=polypeptide|length=620bp
RRRPRPPGAVGGETGGLRDAPYAQSRAFAEKIKSMRRDDWEGVLTELRLA
ERDLALEGSRVTMHMYAGCIRHLAKCRRWRESVDILRAIRAAERVPDRYC
LSAAIKACSAAGEWEPAVELLHEAKSTGLVDAFCYSSAITACGKGGRSKL
AASLLREMEGAGVSPNVITYNSAISACGNGEHWREAVSLLREMKTKGIDP
DAVSYSAAIAACGNGGQWGEATSLLREMEAAGVASDLVCYSAAIAACGSG
GQWEQAVSLLRKMDAAGVTPNEKSFNSAITACGKGGQWKEAVALLREMAT
KGIDPSVVSYSAAIAACGNGGPWEEALSLLREMEGVGITPNVISFNSAIT
ACGNGAQWREAVTLLIEMTTMGITPDTVSYSAAIVACGKAGRWEEAVSLL
REMRVVGITPSVISYSAAITACGNGGQPKAAVSLLREMERAGVAPSVVSY
SAAITACGNRGQWEEAVSLLREMVTVGVAPNVVSYSAAITACGNGGQWEK
AVNLLREMPTKLISPGAISYNAAITACGNGGRWEEAISLLTEMETRGIAV
GVISYNSAITACGDAGRWEQALRLFGEMKTKGLKPCVVTYSAAILACHKA
GQVDDALSLWREMLTAGITP back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
| Term | Definition |
|---|
| IPR002885 | Pentatricopeptide_repeat |
| IPR011990 | TPR-like_helical_dom_sf |
|